SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015113 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015113
Domain Number 1 Region: 31-350
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.95e-121
Family Bee venom hyaluronidase 0.0000135
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015113
Domain Number - Region: 413-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00659
Family Integrin beta EGF-like domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015113   Gene: ENSECAG00000017573   Transcript: ENSECAT00000018523
Sequence length 435
Comment pep:known chromosome:EquCab2:16:36956550:36959348:1 gene:ENSECAG00000017573 transcript:ENSECAT00000018523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHLLPICALFLILLSMAQGSRGPVVPNQPFTTIWNADTEYCLKRHGVDVDVSVFDVVA
NPGQTFRGPNMTIFYSSQLGTYPYYTSTGEPVFGGLPQNASLVAHLARTSQDIQDAMPTS
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQGQHPDWPAPWVEAAAQDQFQKAAQ
DWMAYTLKLGWTLRPHGLWGFYGFPDCYNYDFLSPNYTGQCSPDIRAQNDQLGWLWGLSH
ALYPSIYMPAVLEGTGKALMYVRHRVGEAFRVAVGAGDPNLPVLPYAQIFYDTTNRFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKKYVDTMLGPFILNVTSGARLCSQ
ALCSGHGRCVRRPSHPEALLILNPASFSIKLTPGGGPLTLQGALSLEDQAQMAVEFKCRC
YPGWRGAWCKQQAMW
Download sequence
Identical sequences F6SB02
9796.ENSECAP00000015113 ENSECAP00000015113 XP_005600690.1.31192 XP_008528052.1.77740 ENSECAP00000015113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]