SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015123 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015123
Domain Number 1 Region: 306-532
Classification Level Classification E-value
Superfamily vWA-like 2.91e-60
Family Integrin A (or I) domain 0.00031
Further Details:      
 
Domain Number 2 Region: 9-217
Classification Level Classification E-value
Superfamily vWA-like 3.34e-55
Family Integrin A (or I) domain 0.00028
Further Details:      
 
Domain Number 3 Region: 259-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000227
Family EGF-type module 0.024
Further Details:      
 
Domain Number 4 Region: 221-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000328
Family EGF-type module 0.023
Further Details:      
 
Domain Number 5 Region: 542-583
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0000222
Family Chicken cartilage matrix protein 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015123   Gene: ENSECAG00000017224   Transcript: ENSECAT00000018534
Sequence length 587
Comment pep:known chromosome:EquCab2:22:34370103:34379295:-1 gene:ENSECAG00000017224 transcript:ENSECAT00000018534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGLLCSPLPVLLLLLWPWETQPQFAGPGCRAGPLDLVFVIDSSRSVRPFEFETMRQFLV
GLLRSLDVGPNATRVGVIQYSSQVQSVFPLSAFSRREDMERAIRALVPLAQGTMTGLAIQ
YAMNVAFSVAEGARPPEARVPRVAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADV
GSLRAMASPPLDEHVFLVDSFDLIQEFGLQFQGQLCGKDLCAEGEHGCQHQCHHCISSPG
SYFCHCQASFVLQQGQKSCRTIDHCGFGNHSCQHECVSTFGGPQCRCREGHVLMPDGRSC
QARDLCNGVDHGCEYQCVSEGLSYHCLCPEGRQLLADGKSCNRCREGHVDLVLLVDGSKS
VRPQNFELVKRFVNQIVDFLDVSPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAV
EYMERGTMTGLALRHMVEHSFSEAQGARPRALNVPRVGLVFTDGRSQDDISVWAARAKEE
GIVMYAVGVGKAVEEELRKIASEPAELHVSYSPDFGTMTHLLENLKGSICPEEGISAGTE
LRSPCECESLVEFQGRTLGALETTSLTVLVQLTARLEDLENQLAIQK
Download sequence
Identical sequences F6SAI2
9796.ENSECAP00000015123 ENSECAP00000015123 ENSECAP00000015123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]