SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015167 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015167
Domain Number 1 Region: 619-903
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000476
Family Rhodopsin-like 0.029
Further Details:      
 
Domain Number 2 Region: 140-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000973
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 282-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000133
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 4 Region: 240-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 41-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 98-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 1-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000174
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015167
Domain Number - Region: 182-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000939
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015167   Gene: ENSECAG00000017237   Transcript: ENSECAT00000018586
Sequence length 907
Comment pep:known chromosome:EquCab2:7:4424464:4467628:1 gene:ENSECAG00000017237 transcript:ENSECAT00000018586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NECVDTTICPAYATCTDTSKSYYCSCKKGFLSSNGLAQFQGSGVECKDVDECSKKPSPCG
ANSVCKNLPGKYKCSCLPGFSSPTGNDWNPAKPGRFSCTDINECLSSGICPEHSECTNSL
GSYSCSCRAGFSSSNSICEDVDECADPRSCPEHATCHNSLGSYSCVCNKGFVSSSGNVRF
QGQGETCEDVGECFRNSTLCGPSSICTKILGEYGCSRLPGFFSPDLVTWPHPDAEGSGKY
IDECLNKPCLSNARCTNTPGSYFCTCHPGFAPGNGQLNSTDQETECRDIDECLRDPSPCG
PNSICTNALGSYSCSCIVGFHPNPEGSWIYGNFSCERAPFKCKEDVLARNKQVHLCQTKT
AVEPEDVAFCTQLNAVLSMLDDACENTSAVVSLKDMAENISSVLEQTSTSSNLTREAMSA
LAVVLLESVKRTTLEAFLNPSGNVSQTIRTEHLDVNSRVIKNECSEENMAFSLKAKGDKM
TISCSTIKESGSTEISGVAFVSFAGMESLLNESFFRDSQTPMANSKRKLKINSRVVGGML
TGKKKDGFSEAVNYTLEHLEPKKKTESPMCVSWSTDEEGGRWVPSGCEIIEVSETHTVCR
CKRMANLAIIMASGELTMEFSLFIISHVGMIISLVCLVLAIATFLLCRGIRSQTTSLHLH
LCVCLFLAKLLFLTGVDKTDNETVCAIIAGFLHYLFLACFSWMLVEAVVLFLTVRNLKVV
NYFSSRNIKMLYLCVVGYGLPGVVVAVLASVQPQGYGTPDRCWLKTETKFIWSFLGPVCG
IIVINSILLTLTLWILKQKLSTVNADVSTLKDNRLLTFKAFAQLFILGCSWVLGVFQIGP
MAGIMAYLFTIINSLQGAFIFIIHCLLNHQVREAYRRCFTRKAKSSSQVSQTSGIFLSSM
SSNSKTE
Download sequence
Identical sequences F6RWT4
ENSECAP00000015167 ENSECAP00000015167 9796.ENSECAP00000015167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]