SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015221 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015221
Domain Number 1 Region: 282-424
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 178-283
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 98-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015221   Gene: ENSECAG00000017218   Transcript: ENSECAT00000018648
Sequence length 880
Comment pep:known chromosome:EquCab2:22:26763987:26813163:1 gene:ENSECAG00000017218 transcript:ENSECAT00000018648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAADATTPVTPAGHGHPEANSNEKHLPQQDTRPAEQS
LDMEEKDYGEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQ
VLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDP
AQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSEL
RFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIML
GVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSA
KRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDSDKREEDGESGGRRSEAEEGELRTPTKIK
ELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPS
SPASPSPKGTPEKANERAGLREGSEEKVKPPRPKAPESDTGDEDQDQERDAVFLKDNHLA
IERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSEPEGLVFSRD
LNKGGPGQDDESGGIEDSPDRGACSTLDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTR
VSTVDTSQVDGTAPGGKEFMPTTPSITTETISTTMENSVKSGKGAAAMIPGPQTVATEIR
SLSPIIGKDVLTSTYSATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQA
LALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES
Download sequence
Identical sequences F6QNK6
ENSECAP00000015221 9796.ENSECAP00000015221 XP_005604660.2.31192 XP_014590615.1.31192 XP_014590616.1.31192 XP_014590617.1.31192 XP_014590618.1.31192 XP_014706280.1.49734 XP_014706283.1.49734 ENSECAP00000015221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]