SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015262 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000015262
Domain Number - Region: 189-235
Classification Level Classification E-value
Superfamily Plexin repeat 0.000174
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015262   Gene: ENSECAG00000017520   Transcript: ENSECAT00000018697
Sequence length 392
Comment pep:known chromosome:EquCab2:29:15547616:15951168:-1 gene:ENSECAG00000017520 transcript:ENSECAT00000018697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHYLREITVATGGFIYTGEVVHRMLTATQ
YIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNLGSFTFQATLLIDGRIIF
GYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQHIPNVRRRTIYEYHRVELQMSRITNI
SAVEMTPLPTCLQFNDCGSCVSSQIGFNCSWCSKLQRCSSGFDRHRQDWVDSGCPEESKE
KMCENTEPAESSSQTTTTIRMTTTQFRVLTTTRRAATSQLPTSLPTEDDTKIALHLKDNG
ASTDDSAAEKKGGTLHAGLIVGILILVLIIAAAILVTVYMYHHPTSAASIFFIERRPSRW
PAMKFRRGSGHPAYAEVEPVGEKEGFIVSEQC
Download sequence
Identical sequences F6QFQ3
9796.ENSECAP00000015262 ENSECAP00000015262 ENSECAP00000015262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]