SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015274 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015274
Domain Number 1 Region: 457-567
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 98-221
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-16
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 273-389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-16
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 4 Region: 219-281
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000341
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 573-631
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000126
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 633-694
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 701-759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000367
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 8 Region: 394-459
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000433
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015274   Gene: ENSECAG00000017305   Transcript: ENSECAT00000018709
Sequence length 803
Comment pep:known chromosome:EquCab2:13:19466901:19483473:-1 gene:ENSECAG00000017305 transcript:ENSECAT00000018709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPRAQHPPPPQLLFLILLSCPWTQGLPLKEEEALPEPGSETPTVASEALAELLHGALL
RKGPEMGYLPGPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEGEGHVESPDLG
STASHTLGLLDCTYSIHVYPGYGIEIQVQTLNLSREEELLVLAGGGSPGLAPRLLANSSM
LGEGQVLRSPTNRLLLHFQSPRVPRGGGFRIHYQAYLLSCGFPPRLAHGDVSVTDLHPGG
TATFHCDSGYQLQGEDTLICLNGTRPSWSGEPPSCMASCGGTIHNATLGRIVSPEPGGAA
GPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDSDMDDVPERGL
ISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFS
CLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLSPDWPQSYSPG
QDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGP
DLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTY
QCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTASDAGFPVGSHVQ
YRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENGYQTLYKHHYQ
AGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVAYEELLDNRKLEVTQTTDAS
QLLGGGKRSLDFLIALSLVHCPS
Download sequence
Identical sequences F6QF68
ENSECAP00000015274 9796.ENSECAP00000015274 ENSECAP00000015274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]