SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015313 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015313
Domain Number 1 Region: 7-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.78e-41
Family Galectin (animal S-lectin) 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015313   Gene: ENSECAG00000017748   Transcript: ENSECAT00000018754
Sequence length 136
Comment pep:known chromosome:EquCab2:10:9751450:9753222:-1 gene:ENSECAG00000017748 transcript:ENSECAT00000018754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVVLHKSPLPEGVRVGNVMRIRGVVPDNAGRFFVNLLCSEGPEAEYALHFNPRLDRSEV
VFNTMEQGRWGREERGQGIPFQRGQPFDVLIITTEDGFKAVVGDSEYYHFRHRIPPANVR
LLEVGGDLQLDSVKVF
Download sequence
Identical sequences F6SX07
ENSECAP00000015313 9796.ENSECAP00000015313 ENSECAP00000015313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]