SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015387 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015387
Domain Number 1 Region: 11-130,321-645
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 8.5e-75
Family Integrin alpha N-terminal domain 0.0000657
Further Details:      
 
Domain Number 2 Region: 149-342
Classification Level Classification E-value
Superfamily vWA-like 1.78e-52
Family Integrin A (or I) domain 0.0000000223
Further Details:      
 
Domain Number 3 Region: 648-792
Classification Level Classification E-value
Superfamily Integrin domains 1.52e-32
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 4 Region: 795-920
Classification Level Classification E-value
Superfamily Integrin domains 1.6e-22
Family Integrin domains 0.0092
Further Details:      
 
Domain Number 5 Region: 927-1128
Classification Level Classification E-value
Superfamily Integrin domains 1.67e-18
Family Integrin domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015387   Gene: ENSECAG00000017386   Transcript: ENSECAT00000018839
Sequence length 1162
Comment pep:known chromosome:EquCab2:21:19013140:19101580:-1 gene:ENSECAG00000017386 transcript:ENSECAT00000018839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKVVLGFCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGKWVLIGSPLVGQPQNRTGD
VYKCPVGRSESLPCIKLDLPVNTSIPNVTEVKENMTFGSTLVTNPKGGFLACGPLYAYRC
GHLHYTTGICSDVSPTFQVVNSIAPVRECSSQLDIVIVLDGSNSIYPWKSVTDFLNDLLE
RMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAANKIVQRGGRQTMTALGIDTAR
KEAFTEARGARHGVKKVMVIVTDGESHDNHQLNQVIQDCEKQNIQRFSIAILGHYNRGNL
STEKFVEEIKSIASEPTEKHFFNVSDELALVTIVEALGERIFALEATVDQSAASFEMEMS
QTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKANQLIIPQNTTFNVESTKRNEPLASYLGY
TVNSATVSGDVLYIAGQPRYNHTGQVIIYRMEDGDVKILQTLSGEQIGSYFGSVLTTIDI
DKDSNTDILLVGAPMYMGTEKEEQGKVYVYTLNQTRFEYQMSLEPIKQTCCSSLKHNSCT
KENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHGGAVYIYHGSGRTIRKEYAQ
RIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAALFWSRDVAVVKVTMNFEPN
KVNIQKKNCRVEGKETVCINATVCFDVKLKSKEKTIYEADLQYRVTLDSLRQISRSFFSG
TQERKIQRNITVRKSECTKHSFYIMDDKHDFRDSVRITLDFNLTDPENGPVLDDSLPNSV
HEYIPFAKDCGNKEKCISDLTLDVSTTEKGLLIVRSHNDKFNVSLTVKNKKDSAYNTRTI
VNYSPNLIFSGIEAIQKDSCDSNHNITCKVGYPFLRTGEEVTFKILFQFNTSYLMENVII
HLSATSDSEEPPEALSDNEVNISMPVKYEVGLQFYSSASEYHISIAANETVPEVINSTED
IGNEINIFYLIRKSGQFPMPELKLSISFPNLTSDNYPVLYPSGWSSSENANCRPSSLQDP
RGINSAQKMIISKSEDLKRGTILDCSTCKFATITCNLIPSDMSQVNVSLILWKPTFVKAR
FSSFNLTVRAELQSENASLVLSTGNQKRELAIQISKDGLPGRVPLWVILLSAFAGLLLLM
LLILALWKIGFFKRPLKKKMEK
Download sequence
Identical sequences F6SHD8
ENSECAP00000015387 9796.ENSECAP00000015387 ENSECAP00000015387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]