SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015468 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015468
Domain Number 1 Region: 403-514
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-21
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 584-691
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-20
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 697-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000391
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 756-818
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000612
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 343-408
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000528
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 823-883
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000131
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 7 Region: 226-344
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000103
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 
Domain Number 8 Region: 519-583
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000133
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015468   Gene: ENSECAG00000017142   Transcript: ENSECAT00000018931
Sequence length 981
Comment pep:known chromosome:EquCab2:11:42834753:42879823:-1 gene:ENSECAG00000017142 transcript:ENSECAT00000018931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVIISGLSSEAPTVGEGQAPGIEETDGELTAAPTPEQPERGVHFVTTAPTLKLLNHHPLL
EEFLQEGLERGEEELRPALPFQPDPPTPFTPSPLPRLANQDNRPVFTSPTPSMAAAPTQP
QSREGPWSLEPEPPVLRITALLPPGLSVAVPTPGPGERPNTTPPSRAWTPTSEGPGDMGR
PWAPEITSQHTGLGIEGTITTSTASGDDEETTTTTTIITTTITTVQPPGACSWNFSGPEG
SLDSPTGPGSPPDVGLDCFYYISVYPGYGVEIKVLNISLQEGETVTVEGLGGPDPLPLAN
QSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFPRRPAYGAVTVTSL
HPGGSARFHCATGYQLKGARFLTCLNATQPFWDSQEPVCIAACGGVIRNATTGRVVSPGF
PGNYSSNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEYL
PIEGLLSSGRHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPSYPVGT
TVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDSAGVVLSPNWPEPY
GRGQDCIWGVHVEEDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLGQYSGPRGHFKLFT
SMADVTIQFQSDPGASVLGYQQGFVIHFFEVPRNDTCPELPEIPNGWKSPSQPELVHGTV
ITYQCYPGYQVVGSSVLMCQWDLTWSEDLPSCQRVTSCHDPGDVEHSRRLISSPKFPVGA
TVQYICDQGFVLTGSAILTCHDRQTSTPKWSDRAPKCLLEQLKPCHGLSAPENGARSPEK
RLHPAGATVHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLDGFYSGRNLDVAK
APAASSTLDAAHIAAAIFLPLVAMALLVGGVYLYFSRLQGKSPLQLPQTRPRPYDRITVE
SAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences F6R331
9796.ENSECAP00000015468 ENSECAP00000015468 ENSECAP00000015468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]