SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015519 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015519
Domain Number 1 Region: 258-567
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-116
Family Transglutaminase core 0.000000018
Further Details:      
 
Domain Number 2 Region: 100-257
Classification Level Classification E-value
Superfamily E set domains 7.35e-46
Family Transglutaminase N-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 581-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.22e-29
Family Transglutaminase, two C-terminal domains 0.00042
Further Details:      
 
Domain Number 4 Region: 693-792
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-29
Family Transglutaminase, two C-terminal domains 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015519   Gene: ENSECAG00000017485   Transcript: ENSECAT00000018986
Sequence length 821
Comment pep:known chromosome:EquCab2:1:162145524:162158119:-1 gene:ENSECAG00000017485 transcript:ENSECAT00000018986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDGPRSDVGRWGGNAWQPPTTPSPEPEPEPEPDSRSRRGGRSFWARCCGCCSCRNDDDW
GREPYRDRGSGSRGRGSRSGGRRPDSRGSDSRQPGSRGSGVNAAGDGTIREGMLVVTGVD
LLSSRSDQNRREHHTDEFEYDELIVRRGQPFHMVLLLSRPYESSDHIALELLIGNNPEVG
KGTHVIIPVGKGGSGGWKAQVTKANGQNLNLRVHTSPNAIIGKFQFTVRTRTEAGEFQLP
FDPHNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHG
VLDACLYILDRRGMPYGGRGDPVNVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWV
GSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIY
FDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCS
VESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIITKAIGSSM
REDVTHIYKHPEGSEAERKAVETAAAHGSKPNVYANRDTAEDVAMQVEAQDAVMGQDLTV
SVVLTNRGSSRRTVKLHLYLSVTFYTGVTGSVFKESKKEVVLQPGASDRVAMPVAYTEYK
PHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLSLLGAAVVGQECEVQIVFKNP
LPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLS
QVHGVIQVDVAPAPGGGSFFSDARGNSRSGETIPMASRGGA
Download sequence
Identical sequences F6PW39
9796.ENSECAP00000015519 ENSECAP00000015519 ENSECAP00000015519 XP_001489215.1.31192 XP_008533651.1.77740 XP_008533652.1.77740 XP_014589564.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]