SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015554 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015554
Domain Number 1 Region: 253-532
Classification Level Classification E-value
Superfamily SPOC domain-like 5.49e-82
Family Ku70 subunit middle domain 0.000000000603
Further Details:      
 
Domain Number 2 Region: 33-252
Classification Level Classification E-value
Superfamily vWA-like 4.94e-61
Family Ku70 subunit N-terminal domain 0.00000000659
Further Details:      
 
Domain Number 3 Region: 559-607
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000671
Family SAP domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015554   Gene: ENSECAG00000017563   Transcript: ENSECAT00000019026
Sequence length 608
Comment pep:known chromosome:EquCab2:28:38078258:38102244:1 gene:ENSECAG00000017563 transcript:ENSECAT00000019026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGWESYYKNEGDEEEEEQEEGLEAGGEHKYSGRDSLIFLVDASKAMFESQDEDELTPFD
MSIQCIQSVYTNKIISSNQDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRVLELDR
LKGQQGKKHFQDLLGHGSDYSLSEVLWVCANLFSNVQFKMSHKRIMLFTNEDDPHSSDSA
KASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISVAEDEDLGVHFEESRKLED
LLRKVRAKETKKRVLCRLKFKLNKDIAFTVGIYNMVQKAHKPPPIKLYRETNEPVKTKTR
TFSVNTGSLLLPSDTKRSQTYGSRQIVLEKEETEALKRFDEPGLLLIGFKPLLMLKQHHY
LRPSLFVYPEESLVNGNSTLFIALLTKCLEKEVMAVCRYTPRKNIPPYFVALIPQEEELD
DQKIQVTPPGFQLVFLPYADDKRKVPLTEKVMANPEQVDKMKAIVQKLRFKYRSDSFENP
VLQQHFKNLEALALDLMEPEQAVDLTLPKVEAMDKRLGFLVDEFKELVYPPDYSPKAEVP
VRKQANTYSGNKRPKVEVSEEELKAHISKGTLGKFTVPMLKEACREYGLKVGLKKQELLD
TLTKHFQK
Download sequence
Identical sequences F6PNM7
ENSECAP00000015554 9796.ENSECAP00000015554 ENSECAP00000015554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]