SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015562 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015562
Domain Number 1 Region: 1816-2039
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.16e-82
Family Fibrinogen C-terminal domain-like 0.0000019
Further Details:      
 
Domain Number 2 Region: 1646-1806
Classification Level Classification E-value
Superfamily Fibronectin type III 4.5e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 3 Region: 1553-1642
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-19
Family Fibronectin type III 0.0000229
Further Details:      
 
Domain Number 4 Region: 562-738
Classification Level Classification E-value
Superfamily Fibronectin type III 7.06e-18
Family Fibronectin type III 0.00000936
Further Details:      
 
Domain Number 5 Region: 830-916
Classification Level Classification E-value
Superfamily Fibronectin type III 8.01e-18
Family Fibronectin type III 0.0000828
Further Details:      
 
Domain Number 6 Region: 472-558
Classification Level Classification E-value
Superfamily Fibronectin type III 3.8e-16
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 1466-1553
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000377
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 8 Region: 1104-1189
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000106
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 9 Region: 1014-1098
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000604
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 10 Region: 921-1007
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000168
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 11 Region: 1375-1462
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000662
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 12 Region: 1193-1280
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000395
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 13 Region: 1286-1371
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000073
Family Fibronectin type III 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015562
Domain Number - Region: 260-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000242
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 322-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 353-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00205
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 446-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 135-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0027
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 384-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0027
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 229-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00298
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 106-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 291-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00689
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 167-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0102
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 73-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 42-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0149
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 415-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family EGF-type module 0.071
Further Details:      
 
Domain Number - Region: 196-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0381
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015562   Gene: ENSECAG00000017433   Transcript: ENSECAT00000019034
Sequence length 2046
Comment pep:known chromosome:EquCab2:25:19705467:19766034:-1 gene:ENSECAG00000017433 transcript:ENSECAT00000019034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRLDTRPFCSGRGNFSAEGCGCVCEPGWKGPNCSEPECPGNCHLRGQCLDGQCLCDEGFT
GEDCSQLACPSDCNDQGKCVNGVCICFEGYAGADCSQEVCPVPCSAEHGRCVDGQCVCQD
GFAGEDCNEPLCLNNCNNRGRCVENECVCDAGFTGEDCSELICPKDCFDRGRCINGTCYC
EEGFTGEDCGQLTCPNACRGQGRCEEGQCVCDEGFAGVDCGEKRCPADCHNHGRCVDGQC
ECDDGYTGADCGELQCPNGCSGHGRCVNGQCVCDEGYTGEDCAQLRCPSDCNSRGRCVQG
KCVCEQGFQGYDCSEMSCPHDCHQHGRCVNGMCICDDGYTGEDCRELRCPRDCSHRGRCV
DGRCVCEDGFTGPDCAELSCPSDCHGQGRCVNGQCVCHEGFTGKDCKERRCPSDCHGRGR
CVDGQCICQEGFTAPDCGQRSCPNDCSNWGQCVAGRCICNEGYTGEDCSEVSPPKDLIVT
EVTEETVNLAWDNEMRVTEYLVTYTPTHEGGLEMQFRVPGNQTSTIIQELEPGVEYFIRV
FAILENKKSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMNKE
DEGEITKSLRRPETTYRQTGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVK
DVTDTTALITWFKPLAEIDGIELTYGVKDVPGDRTTIDLTQDENQYSIGNLKPDTEYEVS
LISRRGDMSSNPSKETFTTGNRPSPAHLTGKDHDTSIPRHAGKGDFHSFKCYFKIVAIDG
LIFQRKKQPQITFQSKKYIYSPRASFSAPEAALPCSLKRKAYLSVFLPDLDAPKDLRVSE
TADTSLTLVWRTPSAKFDHYRLNYSLPSGQPVEVRLPKATTSYVLRGLEPGQEYPILLTS
EKGRHKSKPARVTASTDHTPELENLTVTKVGWDGLKLNWTTADQAYEHFVIQVQEVNRVE
AAQNLTVPGSLRAVEVPGLKAATPYRVTIYGVIRGHRTPVLSAEASTGESPNLGEVTVSK
LGWDALKLNWTAPEGAYEQFFIQVQETDRVEAAQNLTVPGGLRSVDLPGLKASTRYSITI
RGVTRDFSTAPLSVEVLTEEVPDLGNLTVTEVSWDALRLDWTTPDEIYEQFVIEVQEADQ
AKEAHSLTVPGSLRSVEIPDLRAGTPYTVTLHGEVRGRRTRPLAVEVMTEELPELGDLVV
TEAGWDGLKLNWTAADQAYELFVIQVQEVNRVEAAQNLTVPGSLRAVEVPGLKAATPYRV
TIYGVIRGYKTPVLSAEASTAGEPEIGNLNVSAITPESFNLSWTATDGAFETFTIEIIDS
NRFLETMEYNVSGAERTAHISGLRPSNDFIIYLSGLAPSIRTKTISATATTEALPLLENL
TISDINPYGFTVSWMASENAFDSFLVTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGY
EVMVSGFTQGHQTKPLRAEIVTEAEPEVDNLLVSDATPDGFRLSWTADEGVFDSFVLKIR
DTKKQSEPLEITLLAPERTRDITGLREATEYEIELYGISNGRRSQPVSAIATTAMGSPKE
IIFSDITENSATVSWMAPTAQVESFRITYVPIAGGTPSVVTVDGTKTQTRLVKLLPGAEY
LVSIIAMKGFEESEPVSGSFTTALDGPSGLVTANITDSEALAIWQPAIAPVDSYVISYTG
ERVPEITRTVSGNTVEYALTSLEPATEYTLRIFAEQGPQKSSAITTKFTTDLDSPRDLTA
TEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVILGPDTTSYSLAELSPSTHYTVKI
QALNGPLRSKLVQTFFTTVGLLYPFPRDCSQAMLNGDTTSGLYTIYLNGDKAQPLEVFCD
MTSDGGGWIVFLRRKNGREDFYRNWKAYATGFGDRREEFWLGLDNLNKITSQGQYELRVD
LRDHGKSAYAVYDRFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTYDKDTDSAITN
CALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSNFRNLE
GRRKRA
Download sequence
Identical sequences F6PN81
ENSECAP00000015562 ENSECAP00000015562 9796.ENSECAP00000015562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]