SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015627 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015627
Domain Number 1 Region: 166-308
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-39
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 66-168
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-27
Family Second domain of FERM 0.00016
Further Details:      
 
Domain Number 3 Region: 2-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.55e-17
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015627   Gene: ENSECAG00000017988   Transcript: ENSECAT00000019107
Sequence length 694
Comment pep:known chromosome:EquCab2:X:104982629:105004866:-1 gene:ENSECAG00000017988 transcript:ENSECAT00000019107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELLKPITKQVKNPKEVVFKFMV
KFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTALMVSHILQSELGDFHEETDR
KHLARTRYLPNQDCLESKITHFHQKHIGRSPAESDILLLDIARKLDMYGIRPHPASDGEG
MQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLIKLHANILVLCKDTLEFTMA
SRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFRYSGRTQRQLLEYGKKGRLK
SLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGGGYYRNVNGVHASEPVLDSR
RRNSAVEVTFAAELERSKPEADPTSLHQSQSSSSFPFIYTDPVFKTDPDPATDPRDYFEE
RSPLSSFRTSCKFADNHMSTSSGLTSKVSPARQLTYTDVPYIPCTGQQVDIMPPQVFFYV
DRPPQVPRRSPIMAEERERQDNCLEPTAMKPAKKSPRNVRMKSFQQDFQELQEAMARTSG
RSNINVDPEEEDPNLEDAFASNIQEQTPKRSQSQSDMKTIRFPFGSEFRPLGPCPALSRK
ADLFTYMFAEDFPTALMDQGAAERYAARESSDSVSEILKPDYYSLYGKGITSLMSRIRLS
SGSLQLDEEDEDVSFTTPTAEDRTLLKPCNYFLT
Download sequence
Identical sequences F6S077
9796.ENSECAP00000015627 ENSECAP00000015627 ENSECAP00000015627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]