SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015664 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015664
Domain Number 1 Region: 199-377
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.83e-33
Family APC10-like 0.0023
Further Details:      
 
Domain Number 2 Region: 1814-1874
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000565
Family ZZ domain 0.0082
Further Details:      
 
Domain Number 3 Region: 1772-1823
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000695
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 89-155
Classification Level Classification E-value
Superfamily EF-hand 0.00000461
Family Polcalcin 0.061
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015664
Domain Number - Region: 1101-1187
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00236
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 
Domain Number - Region: 2701-2790
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0236
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015664   Gene: ENSECAG00000017550   Transcript: ENSECAT00000019150
Sequence length 2956
Comment pep:known chromosome:EquCab2:11:47493545:47603813:-1 gene:ENSECAG00000017550 transcript:ENSECAT00000019150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNASSHSSEDEAGAAGGEAGPHQDWVASGTISGPGPAAPRCRPAALLEPARLREAAAALR
PAPPFESLVSRHHGALLRWLEERLGRGEESVTLDQFRELLEARGAGCSGEQFEEAFAQFD
AEGDGTVDAENMLEALKNSSGANLQGELSHIIRQLQACSLVPGFIDIFSESKEGLGVHSS
MILRFLHRNRLPSAVVPYPMLDHCNNVCTMRASVLKESLDQLVLKEKESPGDLTRSPEMD
KLKSVAKCYAYIETSSNSADIDKMTNGETSSYWQSDGSARSHWIRLKMKPDVVLRHLSIA
VAAADQSYMPQQVTVAVGRTAGDLQEIRDVHIPSNVTGYVTLLENANVSQLYVQINIKRC
LSDGCDTRIHGLRAVGFQRVKKPGVSVSDASAIWYWSLLTSLVTASMETNPAFVQTVLHN
TQKALQHMPPLSLSPGSTDFSTFLSPNVLEEVDSFLIRITSCCSTPEVELTLLAFALARG
SVAKVLSSLCTVTDHLDTHYDASSLISSMASVRQNLLLKYGKPLQLTLQACDVKGKEEKS
GPENLLVEPWTRDGFLTETGKTRASTIFSTGTESAFQVTKIRIMVRRGGIGAQCGLVFAY
NSSSDKFHAEEHFKRFEKYDKWKLQEFRQFVKSRIGCSPDDLGEDDPIGWFELEEEWDEA
EFKLQQCRVAKYLMVKFLCTRQESAERLGVQGLSVSGYLRPARTEAEQSVVCARCRKDAE
ERVCGATLLLRTLQFIQQLAHDLVQQKESGLKYKSFLDFAGLDLQIFWNFYSKLKQNSRE
ECICAQALLLQLLQSCFSVLQRDAPAASEDAQARRPSPGGVEAAKELYTHLCGVVDRVDG
DSVPLEILKQEVRNTLLNGAAIFFPDRQTRRNHLFTMMRNVTEQDHKQSLQLTFRSLCTY
FSDKDPGGLLLLPEKGDLADLHVSEVLAVMSTLLSVAARECELMLDGAGEVHSVLFSLFW
SVQGSLLSWCYLQLKSTDSGAKDLAVDLLEKYVGQFLTSMRVILESLLSQYSGKTVVEKL
CNSVFSMAARQLVIFLLDFCTLDISHCTLLREFSTLTELLKKLCSDPEGGLDKLDVETWQ
QEQPVVLHTWTKESAHNYENNCHEVSVFVSPGATYFEVEFDERCETEKRYDYLEFTDARG
GKTRYDTKVGTDKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAVSWGLD
LQLLVSRLMGRLASQCMALKSVHQLGSNMAVPQAKMALVLNSPLWKPVFRHQICPELGLE
ASWPTHPHQDSKEIKNVRDDPCHHFLLHFAQSDPAQNFCGPYSELFKGFIQACRKQAPKT
DIVAGSTIDQAVNATFAALVYRTPDLYEKLQKYVHSGGKTALSEEFAQVYSLADGIRIWM
LEMKQKSLMSLGNEAEEKLGSEAAEANPESLAKECIQKSLLLLKFLPMGVSSKESCDKLV
TLDESDHLQPLDKRQRTSSVVEEHFQASASPTEAVTPAAGDRSPGLDVHPKLPPSSGPLA
AEVSSATAEEPSSPSTPTRRPPFTRGRLRLLSFRSMEEARPVPTVKEKYPVLKDVMDFIK
DQSLSHESVVKVLSLRKAQARSILEVLRIIQYCAESLGQPHCFHPPYILFLLELLTCQKE
FTNYFGHLEACGADLHKEIRDTYYQFVLFLVKAIKGFSSINDRSLLPALSCVQTALLHLL
DMGWEPSDLAFFVDIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEWMDECQD
GMFEAWYEKIAQEDPEKQRKMHMFIARYCDLLNVDISCDGCDEIAPWHRYRCLQCSDMDL
CKTCFLGGVKPEGHGDDHEMVNMEFTCDHCQGLIIGRRMNCNVCDDFDLCYGCYAAKKYS
YGHLPTHSITAHPMVTIRISDRQRLIQPYIHNYAWLLFAALALYSAHLASAEDVDGEKLD
PQARSSATTLRSQCMQLVGDCLMKAHQGKGLKALALLGVLPDGDSTPENQALSVTVPTGT
SEEQLEKKAVEVAEEPEYGNGKRDVHKAVVPLDFKQRSKADEGVLLMKDPSCQTQISDSP
ADASTPTGLPDAENSEASSEKPVEEKAVTPSPEQVFAECSQKRILGLLAAMLPPLKSGPT
VPLIDLEHVLPLMFQVVISNAGHLNETYHLTLGLLGQLIIRLSPAEVDAAVIKVLSAKHN
LFAAGDSSIMPDGWKTTHLLFSLGAVCLDSRVGLDWACSMAEILRSLNGAPLWRDVIATF
TDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCVGTRCVYMDNANEPHNVIILKHFTEKNRA
VVVDVKTRKRKTVKDYQLVQKGGGQECGSSQTQLSQYSQHFAFIASHLLQTSMDSHCSEA
VEATWVLSLALKGLYKTLKAHSFEETHATFLQTDLLKLLVKKCSKGTGFSKTWLLRDLEI
LSIMLYSSKKEISTLAEHGDLELDERGGQEEEVEQSVSSPSEPEQKKLDPLESLDEPTRI
CFLMAHDALNAPLHILRAIYELQMKRTDSFFLEVQKRFDGDELTTDERIRTLAQRWQPSR
SLRMDEQSAKAVDTDMIILPCLSRPTRCDQATAESNPVTQKLISSTESELQQSYAKQRRS
KSAALLHKELNCKSKRAVRDYLFRVNEATAVLYARHVLASLLAEWPGHVPVSEDILELSG
PAHMTYILDMFMQLEEKHQWEKILQKVLQGCRENMLGTMALAACQFMEEPGMEVQVRESK
HPYNNNTNFEDKVHIPGAIYLSIKFDSQCNTEEGCDELAMSSSSDFQQDRHNFSGSQQKW
KDFELPGDTLYYRFTSDMSNTEWGYRFTVTAGHLGRFQTGFEILKQMLSEERVVPHLPLA
KIWEWLVGVACRQTGHQRLKAIHLLLRMVRCCTHSDLCDLALLKPLWQLFTHMEYSLSED
VTQPVILLPLHRALTELFFVTENRAQELGLLQDYLLALTTDDHLLRCTAQALQNIAAISL
AINYPNKATRLWNVEC
Download sequence
Identical sequences F6RRN3
ENSECAP00000015664 ENSECAP00000015664 9796.ENSECAP00000015664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]