SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015671 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015671
Domain Number 1 Region: 30-348
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.58e-110
Family Bee venom hyaluronidase 0.0000115
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015671
Domain Number - Region: 389-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0148
Family EGF-type module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015671   Gene: ENSECAG00000018117   Transcript: ENSECAT00000019161
Sequence length 415
Comment pep:known chromosome:EquCab2:16:36964276:36966058:1 gene:ENSECAG00000018117 transcript:ENSECAT00000019161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMQLSSALVLGVVLCLGCGQPLLQAPECPFSVLWNVPSAHCKARFGVHLPLEALGITAN
RGQRFHGQKITIFYKNQLGLYPYLGPRGTAHNGGIPQAVPLDCHLARAAYQIHHSLRPGF
TGLAVLDWEEWSPLWAGNWGRRRAYQTASWAWAQRVFPYLDPQEQLHKAQTGFEQAARAL
MEDTLRLGQALQPYGLWGFYRFPACGNGWRGMASNYTGHCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRYRLEEAFRVALTGHIHPLPVLAYARLTHRSSGRFLSQDD
LVQTIGVSAALGAAGVVLWGDLSFSSSEEECWRLHDYLVGTLGPYVINVTRAATACSQQR
CHGHGRCARRDPGQMEAFLHLQPDGSPGAWEFFSCRCYQGWAGPTCQDPRPEEAT
Download sequence
Identical sequences F6RR80
XP_001493753.2.31192 XP_005600678.1.31192 XP_005600683.1.31192 9796.ENSECAP00000015671 ENSECAP00000015671 ENSECAP00000015671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]