SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015708 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015708
Domain Number 1 Region: 275-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000031
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 2 Region: 219-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000372
Family EGF-type module 0.028
Further Details:      
 
Domain Number 3 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015708
Domain Number - Region: 402-434
Classification Level Classification E-value
Superfamily TIMP-like 0.00745
Family Tissue inhibitor of metalloproteinases, TIMP 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015708   Gene: ENSECAG00000018125   Transcript: ENSECAT00000019207
Sequence length 441
Comment pep:known chromosome:EquCab2:13:40341347:40343388:-1 gene:ENSECAG00000018125 transcript:ENSECAT00000019207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPRSCVPALLNAALGAEVLASSTCGRPATRVCDGNPRRAHPAALLTSAGSTAPVCWRSD
SLRKAPLNVTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCGL
DYGRLPAPADGPAGPGPEALCFPEPQAQPDGGGLLAFSVQDGSPPGLDLDSSPVLQDWVT
ATDIRVVLTRPAMLGDTRDSETMVPYSYSATELQVGGRCKCNGHASRCLLDTQGHLICDC
RHGTEGPDCGRCKPFYCDRPWQRATAREAHACLACSCNGHARRCRFNMELYRLSGRRSGG
VCLNCRHNTAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGAAGKTCNQTTGQCPCK
DGVTGLTCNRCAPGFQQSRSPVAPCVKTPVPGPTEESNPVEPQNCDLHCKPARGSYRISL
KKFCRKDYAVQVAVGVRGELR
Download sequence
Identical sequences F6QJR4
9796.ENSECAP00000015708 ENSECAP00000015708 ENSECAP00000015708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]