SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015732 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015732
Domain Number 1 Region: 72-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000251
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015732   Gene: ENSECAG00000017949   Transcript: ENSECAT00000019236
Sequence length 319
Comment pep:known chromosome:EquCab2:14:88124977:88137295:-1 gene:ENSECAG00000017949 transcript:ENSECAT00000019236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSFKLQCHFILIFLMALRGDSRYPELREAAHHDPFLLLSASLKRELAGKPLYRRALRE
LRGIDRRGAIHLHPDRPQLHCAFFIGEPEFITIHYDLVSIDCQGGDFLQVFDGWILKGEK
FPSSQDHPLPTTERYIDFCDSGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFP
CNVISQTPNGRFTLVVPHQHRNCSFSIIYPVAIKISDLTLGHLNGLQLKKPSAGCGGKGD
FVELLGGTGLDPSKMMPLADLCYPFRGPAQMKIGCDNTVVRMVSSGKHINRVTFEYRQLE
PYELENPNGNSIPEFCLSI
Download sequence
Identical sequences F6QCN4
ENSECAP00000015732 9796.ENSECAP00000015732 ENSECAP00000015732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]