SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015739 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015739
Domain Number 1 Region: 73-187
Classification Level Classification E-value
Superfamily DNA-binding domain 6.54e-33
Family Methyl-CpG-binding domain, MBD 0.000000724
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015739
Domain Number - Region: 200-247
Classification Level Classification E-value
Superfamily E set domains 0.000448
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015739   Gene: ENSECAG00000018208   Transcript: ENSECAT00000019245
Sequence length 486
Comment pep:known chromosome:EquCab2:X:122471086:122531127:-1 gene:ENSECAG00000018208 transcript:ENSECAT00000019245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEDKEGKHEPLQPPAHHSAEPAEAG
KAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPK
APGTGRGRGRPKGSGTARPKAAASEGVQVKRVLEKSPGKLLVKMPFQASPGSKAEGGGAT
TSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETV
LPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSTSS
PPKKEHHHHHHHAEPPRAPAPLLPPPPPPPPEPQSSEDPTSPPEPQDLSSSVCKEEKMPR
GGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTP
VTERVS
Download sequence
Identical sequences F6QCH9
ENSECAP00000015739 ENSECAP00000015739 XP_001494268.1.31192 9796.ENSECAP00000015739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]