SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015796 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015796
Domain Number 1 Region: 300-413
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-34
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 144-253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-32
Family Spermadhesin, CUB domain 0.00059
Further Details:      
 
Domain Number 3 Region: 464-576
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.23e-28
Family Frizzled cysteine-rich domain 0.00029
Further Details:      
 
Domain Number 4 Region: 258-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 415-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015796   Gene: ENSECAG00000018171   Transcript: ENSECAT00000019306
Sequence length 579
Comment pep:known chromosome:EquCab2:7:27003359:27007988:-1 gene:ENSECAG00000018171 transcript:ENSECAT00000019306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDCSDIILCVEGTELSKTEFCNPAFEPESGPPCPPPAFQEDASCSIGAPWHGRHRRGLQ
PDCQFSWLCVLLLASLLLLLLGLLVAIILAQLQATPPLGTSYHPLPATTTTGTTPLITTT
TSQATGTPKEQQEAGMSPTPQSTCGGLLPGPRGFFSSPNYPDPYPPNAHCVWHIQVATDH
AIQLKIEALSMESVASCLFDRLEISPEPEGPLLRVCGRVPPPTLNTNASHLRVAFVSDSS
VEGFGFHAWYQAVAPGHGDCAHDEFPCDQLICLLPDSVCDGFANCADGRDETNCSAKFSG
CGGNLTGLQGTFSAPSYLQQYPHQQLCTWHISVPAGHGIELQFHNFSLEAQDECKLDYVE
VYETSNSGALSLLGRFCGAEPPPRLISWHHQLAVLFRTDHGISSGGFSATYRALNVTENP
CGPREFSCQDGGCQSLQWICDTWRNCADSSDDNCSSPLFPPPELACEPVQVEMCIGLSYN
TTAFPNIWVGMATQEEVVEVLRGYKSLTSLPCYQNFRRLLCGLLVPHCTPLGSVLPPCRS
VCQEAERQCQSGLALLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences F6Q3D3
ENSECAP00000015796 9796.ENSECAP00000015796 ENSECAP00000015796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]