SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015809 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015809
Domain Number 1 Region: 364-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Integrin beta EGF-like domains 0.032
Further Details:      
 
Domain Number 2 Region: 93-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 3 Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 4 Region: 285-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 5 Region: 192-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Integrin beta EGF-like domains 0.028
Further Details:      
 
Domain Number 6 Region: 412-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 7 Region: 228-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000015809
Domain Number - Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000198
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number - Region: 58-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number - Region: 140-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015809   Gene: ENSECAG00000018067   Transcript: ENSECAT00000019322
Sequence length 494
Comment pep:known chromosome:EquCab2:17:70216072:70427398:1 gene:ENSECAG00000018067 transcript:ENSECAT00000019322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAGFRNVLLLASSLLFAGLSAVPQSFSPSLRIGPGAACRLSRAESERRCRAPGQPPGG
ALCHGRGRCDCGVCICHVSEPGVYFGPLCECHEWVCETYDGSTCAGHGKCNCGKCECDEG
WSGDACQYPTHCDLTKKKSNQMCKNSQDVICSNAGTCHCGRCKCDNSDGNGLVYGKFCEC
DDRECIDDETEEICGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGKICS
NRGICVCGECSCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
CKVGWYGKKCEHPNSCPLSAEESIKKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGRT
CECDNRRCEDLDGVICGGHGTCSCGRCVCEKGWFGKLCQHPRKCNMTEEQSKSLCESADG
ILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGW
NGNACEIWLGTEYP
Download sequence
Identical sequences F6SSR0
ENSECAP00000015809 9796.ENSECAP00000015809 ENSECAP00000015809 XP_003363266.1.31192 XP_008515528.1.77740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]