SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015818 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015818
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily E set domains 7e-82
Family Arrestin/Vps26-like 0.0000000238
Further Details:      
 
Domain Number 2 Region: 171-387
Classification Level Classification E-value
Superfamily E set domains 4.67e-74
Family Arrestin/Vps26-like 0.00000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015818   Gene: ENSECAG00000017459   Transcript: ENSECAT00000019334
Sequence length 412
Comment pep:known chromosome:EquCab2:7:68850853:68872306:1 gene:ENSECAG00000017459 transcript:ENSECAT00000019334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLLDPEYLKERRVYVTLTCAFRYGRE
DLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCS
VTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAET
TRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNT
AQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLL
REGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVP
ENEAPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNDR
Download sequence
Identical sequences F6SLQ7
ENSECAP00000015818 9796.ENSECAP00000015818 ENSECAP00000015818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]