SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015831 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015831
Domain Number 1 Region: 1280-1344
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.37e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 2 Region: 636-741
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000033
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 3 Region: 745-853
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000942
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 944-1072
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 1509-1554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000356
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 238-291
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000628
Family TB module/8-cys domain 0.0033
Further Details:      
 
Domain Number 7 Region: 108-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000779
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015831   Gene: ENSECAG00000017905   Transcript: ENSECAT00000019347
Sequence length 1560
Comment pep:known chromosome:EquCab2:10:10966195:10992166:1 gene:ENSECAG00000017905 transcript:ENSECAT00000019347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIAACRCCPGQSPRRSRCFRASCRVRSCLPGKCAGPQLCLTPVPRALPSPPSARKRQVSL
NSHPLTLQEARALLRRRRPRGPGGRALLRRRPPQRAPAGQLPLLCPLICHNGGVCVKPDR
CLCPPDFAGKFCQLHSTGARPPAPAMPGLTRSVYTMPLANHRDDEHGVASMVSVHVEHPQ
EASVVVHQVERVSGPWEEADAEAVARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGY
CFRELRRGECASPLPGLRTQEVCCRGAGLAWGVHDCQPCSEHLMNPVHNSCTPAQCGDHF
QSRPIHTVLGRSPHFLTLIHCSHPASVPWPTLAFLELPRCLLSDCQPRSDLALKPHQHLL
VPTFSLLKIAHPAPSQSQTLDPPSSLSHSLLLSCPLSAHPASPFLEGFREICPAGPGYHY
SASDLRYNTRPLGQEPPRVSLSQPRAPPSTSRPPSGFLPTRRPEPRLEPRPEPRPGPELP
LPSIPARTGPEIPESGAIEGIDGIDAGSRSQDGTNRDVTGRGVKAGVGRDKDLEGWMVVT
SGAGVGQARVQILCQFDKSFNLSEPQFPHLELSLKCLAHRECSVMTNNYFSRMALRTYLR
QRSGGLWEDSEGPMIKGSRMGSGSLGLGRNIREDLPGSFCVCPAGARTACEEDVDECAQE
PPSCGPGRCDNTAGSFHCACPAGFRSQGPGAPCQDVDECARSPPPCAYGRCENTEGSFQC
VCPTGFQPNAAGSQCEDMDECENHLACPGQECVNSPGSFQCRACPAGYHLHRGRCTDVDE
CSSGASCGPHGHCTNTEGSFRCSCAAGYRAPAGRPGPCADVNECLEGDFCFPHGECLNTD
GSFACTCAPGYRPGPRGASYLGVTDLGAEGTGHTPIWGGTHSVSGTVLCPGDTVGSKTDT
DMDIMQCPEVGPWICSHENGEQCKGTCESRPVTPHPRPSTLADVDECQEYGPAICGAQRC
ENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGYEG
ARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPTSPEEFDPMTGRCVPPRTSAELD
PGPDSTRFLHSTNVHRASSVPRPRKGHAPSSPPVWGLEAKVLEEAATCWACVQVPVARAS
WAPACFLHTGWIGNSPSLQGGLLKAHFLLLFPGVSLSLSTSLWVSVFRFFSELLTLPGSD
FVSRSMCLSLGPFFLSFCPLTQTLFSHFLALSDPISQPLDPSCSSSCVTASCQTKCSPSE
GPRESDHSQRRGFAGEDPRTDDNLGVCWQEVGADLVCSRPRLDRQATYTECCCLYGEAWG
MDCALCPAQDSDDFEALCNVLRPPAYGPVRPGGFGLPYEYGPDLGPPYQGFPYGPELYPP
PVLPYDPYPPPPGPFARREAPYGAPPFDMPDFEDDGGPYGDSEAPAPPGPGPRWRYRPRD
TRGSFPEPEESPEGGGYAGEHCAPKERRRSCRATKKDMRTEGRLGRAEPVCACVTRDHKR
LTLHVPPSPDINECDEAEAASPLCVNARCVNTDGSFRCVCRPGFAPSHQPHHCTPARPRA
Download sequence
Identical sequences F6SKV7
ENSECAP00000015831 9796.ENSECAP00000015831 ENSECAP00000015831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]