SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000015997 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000015997
Domain Number 1 Region: 307-473
Classification Level Classification E-value
Superfamily vWA-like 4.3e-25
Family Integrin A (or I) domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000015997   Gene: ENSECAG00000018462   Transcript: ENSECAT00000019538
Sequence length 907
Comment pep:known chromosome:EquCab2:5:77416585:77441462:-1 gene:ENSECAG00000018462 transcript:ENSECAT00000019538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLFRSVVFLLVLQLLQGSDTSLVQLNNNGYEGVIIAIDPAVPEDGRIIEQIKDMVTAAS
TYLFEATEKRFFFKNVSILIPENWKENSEYKRPKRESYEHADVLVAPPTLPGRDEPYTKQ
FTACGEKGEYIHLTPNFVLGKNESQYGPSGRLFVHQWALLRWGVFDEYNEDEPYYSAKVT
VSQVTLCSTGITGINRVHTCQGDSCITRECKINSKTKLYEKDCQFFPDQDQTEKASIMFM
QGIDSVVEFCKENNHNREAPSLQNKMCDFRSTWEVISNSEDFKNTTSMVAPPPPPVFSLL
KISQRIVCLVLDKSGSMAGSNRLSRMNQAAKHFLLQTIENGSWVGMVHFDSIALVISNLT
QIISSNERNKLFESLPTEAVGGTSICAGIKSAFEVITDMYSQIDGSEIVLLTDGEDNTAG
SCVDEVKQSGAIIHFIALGPSADQAVIEMSTITGGKHKYASDEAANNGLIDAFAALVSGN
ADLSQQSLQLESKGLTLNNNLWMNGTVIIDSTVGKDTFFLVTWKKEFPNISLWDPNGTQM
ENFTVDTLSKMAYLNIPGTAKVGVWTYSLQAKQNSEILTITVNSRAANPSVPPITVNAKM
NKDTNSFPSPMIVYAEILQGFVPILGANVTAFIESNSGKTEVLQLLDNGAGADSFKNDGV
YSRYFTAYSENGRYSLKVRAHGGTNAATRSLRHPLNRAAYIPGWVVDGKIKGNPSRPEID
ADTQTPLESFSRTASGGAFVVSNVSNLPLPDLYPPSQITDLEATRDGDDISLTWTAPGDD
FDVGKAQQYIIRISGSLLDLRDNFDDALQVNTTDLLPKEANSEETFAFTPGHISEGNATH
IFIAIQSVDKSNLASKVSNIAQVALFIPEADSSPEENSAGSGANVSPFVLLVSGSVAIVS
IISSATI
Download sequence
Identical sequences F7D5W4
ENSECAP00000015997 ENSECAP00000015997 9796.ENSECAP00000015997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]