SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016034 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016034
Domain Number 1 Region: 17-123,312-616
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.27e-69
Family Integrin alpha N-terminal domain 0.0000518
Further Details:      
 
Domain Number 2 Region: 105-334
Classification Level Classification E-value
Superfamily vWA-like 6.68e-51
Family Integrin A (or I) domain 0.0000000822
Further Details:      
 
Domain Number 3 Region: 773-917
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-31
Family Integrin domains 0.0033
Further Details:      
 
Domain Number 4 Region: 616-772
Classification Level Classification E-value
Superfamily Integrin domains 1.62e-27
Family Integrin domains 0.0079
Further Details:      
 
Domain Number 5 Region: 947-1094
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000523
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016034   Gene: ENSECAG00000017418   Transcript: ENSECAT00000019583
Sequence length 1142
Comment pep:known chromosome:EquCab2:13:18554880:18591972:-1 gene:ENSECAG00000017418 transcript:ENSECAT00000019583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHRVLLLTALTLCHGFNLDTENAMIFQENARGFGHSVVQLEGSRVVVGAPQEIKAANQT
GSLYQCDYSTASCEPIPMQVPLESVNMSLGLSLAFATNPFRLLACGPTVHQICKEHIYVN
GFCFLFGSNLRQQPQRFPEALRECPQQESDIAFLIDGSGSIYENDFQKMKEFVTIVMNQF
KKSKTLFSLMQYSDTFQTHFTFKEFANNPNPGSLVRPINQLGGRTHTATGIRKVVRELFH
SRNGARKNALKILVVITDGEKFGDRLEYEDVIPEADQEGIIRYVIGVGIAFSIEKSREEL
NTIASKPARDHVFRVNNFEALKTIQNQLQEKIFAIEGTQTGSTSSFEHEMSQEGFSAAVT
SSGPLLGAVGSFDWAGGAFLHTSRDKFTFINLTMVDPDMKDAYLGYAVEVVSRRQVQNFV
MGAPRYQHTGLVAMFRQNAGAWENNAYIKGSQIGSYFGASLCSVDVDRDGSSDLVLIGAP
HYYEQTRGGQVSVCPLPRGRAKWQCKSVLRGEQGHPWGGFGAALTVLGDVNGDKLMDVAI
GAPGEQENQGAVYLFHGTSGLGISPSHSQRIAGSQLLPRLQYFGQSLSGGRDLTMDGLVD
LAVGAQGHVLLLRSQPVLRVEVTMAFTPGEVARNIFDCRDQVVRNQTAGEVRVCLRVRKS
TPDRLREGEIQSIVTYDLALDPNRLLRRAVFDETKNSTCRQIQNLGLNQECKTLKLLLPK
CGQDSVAPIVLRLNFSLVGKPSSSFGNLRPVLAVDAQRLFTALFPFEKNCGSDGICEDDL
SITLSFMSLNTLVVGGPREFNVTVTVKNQGEDSYNTQVTFFYPPGLSYRMLSRDQVAKSF
LGSRCACNSTEEPGALKSCTCNISRPIFPENSEVTFNITFVMNSTASFGNRLLLKAKVTS
ENNMPQTNKTQFQLELPVKYAVYMVVTSGEASTKYLNFTASEKTSRIIKHEYQFKNLGQR
TPPISVVFWVPIRLNQSAVWDHPQVTFSQELSRTCHTKERVPPLSDFLVELKKTPVLNCS
IAVCQRIQCDIPSFGIQQEFNVALEGNLSFGWYSKALQNYLQIVSTAEILFNDSIFTLLP
GQEAFVRAQTDTKVELYEMHDPVPLIVGSSVGGLVLLALITGLYKLGFFKRQYKDMMNEA
AP
Download sequence
Identical sequences F7ASK6
ENSECAP00000016034 9796.ENSECAP00000016034 ENSECAP00000016034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]