SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016082 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016082
Domain Number 1 Region: 248-501
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 9.03e-70
Family Creatinase/aminopeptidase 0.0000036
Further Details:      
 
Domain Number 2 Region: 66-247
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 2.98e-40
Family Creatinase/prolidase N-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016082   Gene: ENSECAG00000018457   Transcript: ENSECAT00000019636
Sequence length 507
Comment pep:known chromosome:EquCab2:28:37436250:37498431:1 gene:ENSECAG00000018457 transcript:ENSECAT00000019636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLLSAAKLVPAVVSARSLSGCVSCSQRRYSLQPIPERRVPNRYLGQPSPFTHPHLLRP
GEVTPGLSQVEYALRRHKLMSLIHKEAQGQSGTDQTVVLLSNPTYYMSNDIPYTFHQDNN
FLYLCGFQEPDSILVLQSLPGKQLPAHKAMLFVPRRDPSRELWDGPRSGTDGAIALTGVD
EAYTLEEFQHLVPKLKAETNMVWYDWMRPSHAQLHSDYMQHVTEVKARSKNKVRAVHQLV
QRLRLVKSPAEIERMQIAGKLTSQAFIETMFASKAPVEEGFLYAKFEFECRARGADILAY
PPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAEL
YEAVLEIQRGCLTLCSPGTSLENIYTMMLTLIGQKLKELGIMKNIKEDNAFKAARKYCPH
HVGHYLGMDVHDTPDMPRSLPLQPGMVITVEPGIYIPEDDRDAPEKFRGLGVRIEDDVVV
TQDSPLILSADCPKEMNDIEQICSRAS
Download sequence
Identical sequences F7AME1
ENSECAP00000016082 XP_001502337.1.31192 XP_005606721.1.31192 XP_005606722.1.31192 XP_005606723.1.31192 XP_005606724.1.31192 9796.ENSECAP00000016082 ENSECAP00000016082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]