SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016090 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016090
Domain Number 1 Region: 380-1121
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-234
Family Motor proteins 0.00000000182
Further Details:      
 
Domain Number 2 Region: 2036-2119
Classification Level Classification E-value
Superfamily SH3-domain 0.000000081
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 3 Region: 2466-2582
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000131
Family Second domain of FERM 0.013
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016090
Domain Number - Region: 2583-2634
Classification Level Classification E-value
Superfamily PH domain-like 0.00292
Family Third domain of FERM 0.056
Further Details:      
 
Domain Number - Region: 1391-1446
Classification Level Classification E-value
Superfamily ISP domain 0.0857
Family Ring hydroxylating alpha subunit ISP domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016090   Gene: ENSECAG00000018420   Transcript: ENSECAT00000019644
Sequence length 2698
Comment pep:known chromosome:EquCab2:11:59750102:59799308:-1 gene:ENSECAG00000018420 transcript:ENSECAT00000019644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASGRLGPQRSPALGAPRPPSPPPLLGYSPRRRSLHLPSCLPHMWRRLSEPPTGAVKPRVR
QPFHRPPSAGSWPAAAAAPELRESPREPEDSETPWMVPPLAPSWDVDMPPTQRPPSPWPG
GVGSRCGFTSPHPVPKNPFLQHVGPEPSLAPQLEGPASDSTSVFLGRHCEPGSGQLAKSA
GPPPNKPGEEATPRDSQPPAETEPLTLTPSKDSSPEQKTLRLSLSHPLAACDRKRATWPP
WRRWGTLPSIPAPLVSTGASGPLPKVGERCQAGPGRFAVVMPQVQKLSSFQRLGLATMQP
PSKPAQDPEPRPKPRAWSLLWSHLWLPVEAHQPWPRVHTRHLSCCSPGPGAACLPHGGPW
EEVGPKSWWKKMHSIRNLPSSRFREQHWEDGVEDMTQLEDLQETTLLSNLKTRFERNLIY
TYIGSILVSVNPYRMFGIYGPEQVQQYSGRALGENPPHLFAIANLAFAKMLDATQDQCII
ISGESGSGKTEATKLILRYLAAMNPKRGVMQQVSLSPSTPWEEQTGRGKSKQSDLWSVLG
LFGPRVLNNGVMSTHLLGGFPLCTHPPTLQAKNERNYHIFYELLAGLPAQLRRAFCLQEA
ETYYYLNQGGNCEISGKSDADDFRRLLAAMEVLGFSSEDQDSIFRILASILHLGNVYFEK
YETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFRVTETMQEKIFTPLTVESAVDAR
DAIAKVLYALLFSWLIARVNALVSPQQDALSIAILDIYGFEDLSFNSFEQLCINYANENL
QYLFNKIVFQEEQEEYIREQIDWQEIAFADNQPCINLISLKPHGILRILDDQCCFPQATD
HTFLQKCHYHHGAHPLYSKPKMPLPEFTIRHYAGKVTYQVHKFLDKNHDQVRQDVLDLFM
RSRTRVVAHLFSSHAPQAAPQRLGKSSSVSRLHKAHTVAAKFQQSLLDLVEKMERCNPLF
VRCLKPNHKKEPGLFEPDVVMAQLRYSGVLETVRIRKEGFPVRLPFQVFIDRYRCLVALK
HSLPVSGDTCVSVLSRLCTVTPNMYRVGISKLFLKEHLHQLLESMRARVLNLAALTLQRR
LRGFLIQRRFRSLRRKVVLLQSRARGYLARQRYQQMRRRLVKFRSLVHTYMSHRRYLKLR
AEQRLRVEEVRLREQEELSKREVVAVGHLEVPAELAGLLRAVAGLRPAREPQVAPVRTPR
LQAEPRVTLPLDINNYPMAKFVRCHFKEPAFGMLTVPLRMPLTRLPVELHTEAVGVFKLI
LRFMGDPHLHGAQENIFGNYIVQKGLAVPELRDEILAQLANQVWHNPSAHNAERGWLLLA
ACLSGFAPSSSLSKYLLKFVSDYGRNGFQAVCQHRLMQAMGRAQQQGPGAARTFPPTQLE
WIATQEKAAMALDVGCFNGDQFSCPVHSWSTGEEVAGDMLRHRGLADGWRGWTVAMKNGV
QWAELAGHDYVLDLVSDLELLRDFPRQKSYFIVGAEGPMAGRGGSRVVFGNSWDSDEETP
TRPQPQGHMPKGADSDGYCSHNEDSTNGETEAQRGTATHQDLDSLREPVVPHRGLDRYLD
SLFDPVLFHGDADLEKPTAIAYRMKGGGQPGRGGGSSTEDSPRSPPEPKPKPSLDASTLA
LQQAFIHKQAVLLAREMTLQAMALQQQPLGPTPRPLLPEKPPAPEAWPKSVGTGPPAKPV
LLRPAPKPLAPAPLAKAPRPLTKPVAAPILALDRASLETTSPCSELVRHSPLNSEHFPQP
TQQIKGIVRQYQQPPRGGQPGARRKDGGRVFVKQADPHEEALMILKGQMSHPAVAPGTQV
PREDVALVKPATSAPRPSLGPTPVLPSRSLEPAEEPIQTRLHRLLSPHVYGYRDAPWRIV
LRKEVFYPKDSYSHPVQLDLLFRQILHDTLSEACLRISEDERLKMKALFAQNQLDTQRPL
VTESVKRAVVSTARDSWEVYFSRLFPATGSVGTGVQMLAVSHTGIKLLRMVKGSREAGGQ
LRVLRTYSFADILFVAIPSQNMLEFNLASEKVILFSARAHQVKTLVDDFILELKKDSDYV
VAVRNFLPEDPALLAFHKGDIIHLQPMEPPRMGYSAGCVVRKKVVYLEELRRRGPDFGWR
FGTIHGRVGRFPSELVQPAAAPDFLQLPTEPGRGRAAAVAAAVASTAAAREVGRRREGPP
VRAGSTDRGEDGLALPPYTMLEFAQKYFRDPQRRPQDGLRLKSKEGQESRTLEDMLCFTK
TPLQESLIDLSDSSLNKMATDMFLAVMRFMGDAPAKGQSELDVLCALLKLCGDHEVMRDE
CYCQVVKQITDNTSTKQDSCQRGWRLLYIVAAYHSCSEVLQPHLVRFLQDVSRTPGLPFQ
GIAKACEQNLQKTLRFGGRLELPSSMELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVA
LDVVEEICAEMALTRPEAFDEYVIFVVTNRGQHVCPLSRRAYILDVASEMEHVDGGYMLW
FRRVLWDQPLKFENELYVTMHYNQVLPDYLKGLFSSVPASRPSEQQLQQVSKLASLQHRA
KGHLYLPSVREVQEYIPAQLYCTTAGSAWLNLVSQHRQQTQALSPHQARTQFLGLLSALP
MFGSSFFFVQSCSSVAVPAPCILAVNQNGLNFLSTETHELMVKFPLKEIQSTRTQRPTAS
SSYPYVEITLGDVAAQRTMQLQLEQGLELCRVVAVHVESLLNARERRLTLPPSEITLL
Download sequence
Identical sequences F7AM84
9796.ENSECAP00000016090 ENSECAP00000016090 ENSECAP00000016090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]