SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016095 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016095
Domain Number 1 Region: 3952-4323
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.01e-101
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 2962-3327
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.94e-92
Family Regulator of chromosome condensation RCC1 0.0015
Further Details:      
 
Domain Number 3 Region: 4460-4791
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.19e-88
Family Hect, E3 ligase catalytic domain 0.0000379
Further Details:      
 
Domain Number 4 Region: 423-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.31e-87
Family Regulator of chromosome condensation RCC1 0.008
Further Details:      
 
Domain Number 5 Region: 2730-2912
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.15e-33
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2555-2632
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.23e-29
Family CPH domain 0.00065
Further Details:      
 
Domain Number 7 Region: 1864-1930
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.62e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 8 Region: 1207-1291
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.00000000000275
Family Cytochrome b5 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016095
Domain Number - Region: 2453-2507
Classification Level Classification E-value
Superfamily UBA-like 0.000322
Family UBA domain 0.008
Further Details:      
 
Domain Number - Region: 3620-3710
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016095   Gene: ENSECAG00000017677   Transcript: ENSECAT00000019649
Sequence length 4837
Comment pep:known chromosome:EquCab2:1:113626895:113881458:-1 gene:ENSECAG00000017677 transcript:ENSECAT00000019649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDSFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIIYTGTELTQNGELPP
RKDDGVDTQSGTKKEDLNDKEKKDEEEMPAPAYRAKSILESWVWGKQPDVNELKECLSVL
VKEQQALAIQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSSISLPPVDK
KSSRPTGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGSIPLQDQHLALAILLELAVQ
RGTLSQMLSAILLLLQLWDSGTQETDNERSAQGTSAPLLPLLQRFQSIICSKDAPHTEGD
THLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNS
DTLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPK
VISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAVPMLVAG
LKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
VKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPSALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLNLLRLQ
LHAAISHQVDPEFLGLGLGSVLLNSLKQTVVALASSTGVLSTVQAAAQAVLQSGWSMLLP
TAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEVSASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQLLRNI
ASQTVVRLKDIAHRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGESTGHTSDISS
PELMGVGSLLKKYTALLCTHIGDILPVASSIASTSWRHFAEVACIVEGDFTGVLLPELVV
SIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDYEELAWPGIMESFFTGQ
NCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTRNSILAQFVGEDPVV
ALEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASY
LAVSTPLSPVEVECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPVSKSRLCS
HRRALGDHSQAFLQAVADNNIQDHNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRL
LLCCLLKHEDLGHVALSLVHAGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQG
RSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKMLSSVPRWRRIAQKIIRERRKKRV
PKKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPITIKSPKDKWQPLLSTVTGVHKY
KWLKQNVQGLYPQSALLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLA
TKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWA
VQNIRNVLIDANDKFKDLGIQPVPLQTITNENPSGPSLGTTPQARFLLVMLSMLTLQHGA
NNLNLLLNSGTLALTQTALRLIGPSCDNVEEDMNASARGASATVLEETRKETAPVQLPVS
GPELAAMMKVGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMG
KEGKYDLKLAELPASTQPSAEDSDTEDDSEAEQTERNIHPTAMMLNSTVNLLQTLCLSAG
VHAEIMQNEATKTLCGLLRMLVESGTTDKTSSPNKLVCREQHRSWCTLGFVRSIALTPHM
CAALSSPQWITLLMKVVEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMKCLVEK
LFGFLGCLLTTCSSDIPFLRESTLRRRRARPQASLTATHSSTLAEEVVALLRTLHSLGQW
NGLINKYINSQLHSVTHSCAGKPSEGALLEDYLPDSENPEVGGLMAVLAVIGGIDGRLRL
GGQVMHDEFGEGTVTRITPKGKITVQFSDMRMCRICPLNQLKPLPAVAFSVTNLPFTEPM
LSVWAQLVNLAGSKLEKHKVKKSPKQGFAGQVDLDLLRCQQLKLYILKAGRALLSHQDQL
RQILSQPAVQEATAAHTDDGAAVSPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFD
KQELEAAALAVCQCLAVESTHPSSPVFEDCSSSEATTPVPVQHVHPVRAKKRKQSPVPAL
PIVVQLMEMGFPRRNIEFALKSLTGASGNATGLPGVEALVGWLLDHADVQVTDLSDADTG
SEECSDEEVVEDVDDVAYAVSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRC
CRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSPSHI
KIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDVIVDFPQQSHWTGLLSEMELV
PSVHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTRKHNTRHTFGRINEPGQSAIF
CGRSGKQLKRCHNSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHW
IRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPTDTTVSLLN
DCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGN
SGSLIRKKAAGLGIQRALISVVMVWGCLRYPQAQGPCWSLHIKVPSFSETLSALNVVQVA
GGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQVTALSSYVVKKVAVHSGGRH
ATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSPLTSSGE
LYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGD
GDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGH
GSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDAGQVYAWGDNDHGQQGNGTTTVNRK
PTLVQGLEGQKITRVACGSSHSVAWTTVDMATPSVHEPVLFQTARDPLGASYLGVPSDAD
SSAASNKISGVNHSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMP
AGMIAPMECPSFSSSAPPSDASAMASPMNGEECVLPVDIEDRLSPNLWQEKRGEIISSED
AVTPSAVTPSASSASSRPFIPVTDDPGAASIIAETMTQTKEDVESQNKASGPEPQSLDEF
TSLLVVDDTRVMVDLLKLSVCSRAGDKGRDVLSAVLSGMGTAYPQVADMLLELCVTELED
VATDSQSGRLSSQPVVVESSHPYTDDTSSSGTVKIPGAEGLRVEFDRQCSTERRHDPLTV
MDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKD
LLSDRCVLSCPSMDLVTCLLDFRLNLGSNRSIVPRLAASLAACAQLSALAASHRMWALQR
LRKLLTTEFGQSININRLLGDNDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRG
GKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLF
LDEVAKKIRELMADSENMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGW
GHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRL
GIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRS
PCDRPRVIESLRGIELVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLV
EALQGHRVVDVACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGL
GVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATG
SLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVPALQGKKVNRVACGSAHTLAWS
TSKPASAGKLPTQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDETG
LGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGP
DGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGL
TPLLIVTPNGRDESGANRDCYLFSPAARAPVHTNMFRFLGVLLGIAIRTGSPLSLNLAEP
VWKQLAGMNLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSS
KYTHITLDNRTEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGS
PDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFR
GRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYA
RIALTGEPAADDSSDDSENEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences F7AM44
ENSECAP00000016095 ENSECAP00000016095 9796.ENSECAP00000016095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]