SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016141 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016141
Domain Number 1 Region: 484-742
Classification Level Classification E-value
Superfamily NHL repeat 3.4e-47
Family NHL repeat 0.00000872
Further Details:      
 
Domain Number 2 Region: 322-418
Classification Level Classification E-value
Superfamily E set domains 2.47e-24
Family Filamin repeat (rod domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 16-91
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000159
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 4 Region: 107-169
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000687
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016141   Gene: ENSECAG00000018279   Transcript: ENSECAT00000019702
Sequence length 744
Comment pep:known chromosome:EquCab2:7:75434259:75449084:-1 gene:ENSECAG00000018279 transcript:ENSECAT00000019702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKREDSPGPEVQPMDKQFLVCSICLDRYRCPKVLPCLHTFCERCLQNYIPAQSLTLSCP
VCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGARDPEDPHPLSAVAGRPLSCPNHEG
KTMEFYCEACETAMCGECRAGEHREHGTVLLRDVVEQHKAALQRQLEAVRGRLPQLSAAI
ALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLEAICGAKQKVLQTQLDT
LRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVL
EVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQQASLTVTTKDKDGRLVRTGSA
ELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFRVRALR
PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRG
REKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVA
VDTNGDIIVADYDNRWVSIFSPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVF
TFQPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFG
SHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGLA
LTSDGHVVVADAGNHCFKAYRYLQ
Download sequence
Identical sequences F7A5K2
ENSECAP00000016141 ENSECAP00000016141 XP_014597341.1.31192 9796.ENSECAP00000016141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]