SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016162 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016162
Domain Number 1 Region: 6-219
Classification Level Classification E-value
Superfamily vWA-like 2.23e-58
Family Integrin A (or I) domain 0.00048
Further Details:      
 
Domain Number 2 Region: 245-436
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.38e-30
Family Laminin G-like module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016162   Gene: ENSECAG00000018382   Transcript: ENSECAT00000019725
Sequence length 1627
Comment pep:known chromosome:EquCab2:9:78106853:78373475:-1 gene:ENSECAG00000018382 transcript:ENSECAT00000019725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSLRGNTVACLLWMLLLWSGDSGCQAQRAGCKTVHYDLVFLLDTSSSVGKEDFEKVQQW
VANLVDTFEVGADHTRVGVVRYSDQPTTAFELGHFRSREAVKAAARRLAYHGGNTNTGDA
LRYITRHSFSPQAGGRPGDRAFKQVAILLTDGRSQDLVLDAAATAHRAGIRIFAVGVGEA
LKEELEEIASEPKSAHIFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHINGGT
KEITGFDLMDLFSVKEILGKRENGAQSSYVRMGAFPVVQRTEDVFPQGLPDEYAFVTTFR
FRKTSRKEDWYIWQVIDQYGIPQVSIRLDGENKAVEYNAVGAMKDAVRVVFRGPLVNDLF
DRDWHKIALSIQAQNVSLYVDCALVQTLPIEERENIDIQGKTVIGKRLYDSVPIDFDLQR
IVIYCDSRHSELETCCDIPSGPCQVTVLREPSPPPLQPPTAGSEQIGYLKTINCSCPAGE
KGEKGSDGPAGLPGPKGDMGATGLVGAPGPKGEKGDVGRGPFVQGEKGEKGSLGPPGPPG
RDGSKGMRKHPGEPGEPGLPGEVGMRGSQGPPGLPGPPGHVGAPGLQGERGVKGARGEKG
ERGLDGFPGKQGETGEQGRPGPPGAAGPQGEKGDVGPAGPPGVPGSVVQREGLKGEQGAP
GPRGHQGPPGPPGAPGPTGPEGKEGPPGLQGLRGKKGEVGPSGLPGPLGLQGPPGPPGVP
GPPGPGGPPGLPGEIGFPGKPGFPGQAGPPGKDGLNGPPGLPGPKGEPGERGEDGLPGKP
GLRGEVGEQGLAGRPGEKGEAGLPGAPGFPGVRGEKGEQGEKGELGLPGLKGDRGEKGEA
GPAGPPGLPGTTSLFTPHPRVPGEQGPKGEKGDPGVPGEPGSPGRPGELGPRGPTGPPGA
KGQEGAHGVPGPTGNPGAPGPVGSPGPSGPPGSVGPPGVRGPPGKDGERGEKGAAGEEGS
PGPAGLRGDPGAPGLPGPPGKGKDGDPGLRGPPGLPGPLGSKVRSCGKILGSRPASAGIK
CITGDRGAPGIPGSPGNRGDPGIGVAGPPGPSGPPGDKGPPGSRGLPGFPGPQGPAGQDG
LPGNPGERGPPGKPGPSPFLSPGDINLLVKDVCNDCPPGPPGLPGLPGFKGDKGLPGKPG
REGPEGKKGDAGLRGLPGAPGVAGPQGSKGERGADGEVGQKGDQGHPGVPGFMGPPGNPG
PPGAGGIAGAAGPPGIQGPPGKEGPPGPQGPSGLPGIPGEEGKEGRDGKPGPPGEPGKTG
EAGLPGPEGARGPPGFKGHTGDSGAPGPRGEPGAMGPPGQEGLPGKDGDIGPTGPQGPQG
LRGLPGKNGSPGSPGDPGTPGSPGQKGNKGENGSPGLPGFLGPRGPSGEPGEKGVPGKEA
RGVPGRPGEAGPKGERGDPGVKGDKGAPGGKGQPGDPGIPGHKGHTGLTGPQGPPGENGP
AGPPGPPGQPGFPGLRGESPSLDTLRRLIQEELSKQLETKLAYLLAQMPPAHVKASQGRP
GPPGPPGKDGLPGRAGLMGEPGRPGQVGLEGPSGPIGPKGERGAKGDPGAPGVGLRGEMG
PPGIPGQPGEPGYAKDGLPGHPGPQGETGPAGHPGPPGPPGPPGQCDPSQCAYFANLAAR
PGNVKGP
Download sequence
Identical sequences F7A1I5
ENSECAP00000016162 ENSECAP00000016162 9796.ENSECAP00000016162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]