SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016458 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016458
Domain Number 1 Region: 189-430
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.87e-85
Family Eukaryotic proteases 0.00031
Further Details:      
 
Domain Number 2 Region: 99-196
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000432
Family Hepsin, N-terminal domain 0.036
Further Details:      
 
Domain Number 3 Region: 54-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016458   Gene: ENSECAG00000018818   Transcript: ENSECAT00000020069
Sequence length 434
Comment pep:known chromosome:EquCab2:7:26007295:26025036:1 gene:ENSECAG00000018818 transcript:ENSECAT00000020069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQDPGSDQPLNSFDVTPLRKPRPLETFKKVGDPIAALLSLAIIVTVAVLIKEILDRSYFL
CGQPLHFIPRRQVCDGQPDCASGEDEQHCVENFPHGPPATVRLSKDRSTLQVLDPATRNW
ASACFDNFTEALAQTACGQMGYDSKPTFRAVEIGPDQELDVVKITGNSQELQVRNSSGPC
LSGALVSLHCLACGESLKAPRVVGGETASVDSWPWQVSIQYNKQHICGGSILDPHWILTA
AHCFRKHLDVSNWKVRAGSDKLGNFPSLPVAKIFVTELNITYPKENDIALVKLQFPLTFS
GTVRPICLPFSDEKLAPATPLWVIGWGFTEQDGGKMSDTLLQASVQVIDSARCNAEDAYQ
GEVTEEMLCAGIMEGGVDTCQGDSGGPLMYQSGQWQVVGIVSWGHGCGGPGTPGVYTKVT
AFLNWIYNVRKVSL
Download sequence
Identical sequences F7A454
ENSECAP00000016458 9796.ENSECAP00000016458 ENSECAP00000016458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]