SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016485 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016485
Domain Number 1 Region: 109-356
Classification Level Classification E-value
Superfamily vWA-like 4e-86
Family Integrin A (or I) domain 0.000000000445
Further Details:      
 
Domain Number 2 Region: 352-441
Classification Level Classification E-value
Superfamily Integrin domains 3.71e-33
Family Integrin domains 0.00000381
Further Details:      
 
Domain Number 3 Region: 608-692
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.05e-23
Family Integrin beta tail domain 0.00000483
Further Details:      
 
Domain Number 4 Region: 5-59
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000157
Family Plexin repeat 0.0000514
Further Details:      
 
Domain Number 5 Region: 566-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 6 Region: 524-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000206
Family Integrin beta EGF-like domains 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016485
Domain Number - Region: 492-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family Integrin beta EGF-like domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016485   Gene: ENSECAG00000017625   Transcript: ENSECAT00000020100
Sequence length 764
Comment pep:known chromosome:EquCab2:11:17206116:17237153:-1 gene:ENSECAG00000017625 transcript:ENSECAT00000020100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGPNICTTRGVSSCRQCLAASPMCAWCSDAALPLGSPRCNLKENLLKDNCALGSIEFPV
SEAIILEARPLSDKGSGDSSQITQVSPQRIALRLRPDDSKNFSVQVRQVEDYPVDIYYLM
DLSYSMKDDLGSIQNLGTKLASQMRKLTSNLRIGFGAFVDKPVSPYMFISPPEALKNPCY
DMKNVCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDKKIGW
RNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHIGSDNHYSASTTMDYPSLGLMTEK
LSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSTDSSNVLQLIVDAYGKIRSKVELE
VRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKP
VGFKDSLTVQVTFDCDCACQAWAEPYSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDY
RPSQQDECSPREGQPICSQRGECLCGQCVCHTSDFGKITGKYCECDDFSCVRYKGELCSG
HGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTC
EKCPTCPDACTFKKECVECKKFERGALYEENTCTRYCRDEIESVKELMDTGKDAVNCTYK
NEDDCVVRFQYYEDASGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLATLLIWKLL
ITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Download sequence
Identical sequences F7A370
ENSECAP00000016485 ENSECAP00000016485 9796.ENSECAP00000016485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]