SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016522 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016522
Domain Number 1 Region: 242-502
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.06e-77
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 130-200
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000832
Family Kringle modules 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016522
Domain Number - Region: 29-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000107
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 63-102
Classification Level Classification E-value
Superfamily FnI-like domain 0.000549
Family Fibronectin type I module 0.0041
Further Details:      
 
Domain Number - Region: 1-17
Classification Level Classification E-value
Superfamily Kringle-like 0.000974
Family Fibronectin type II module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016522   Gene: ENSECAG00000019001   Transcript: ENSECAT00000020144
Sequence length 511
Comment pep:known chromosome:EquCab2:3:116800015:116807879:-1 gene:ENSECAG00000019001 transcript:ENSECAT00000020144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CATTHNYDRDRAWGYCMQLGRRQGQSLCSGPCLNGGFVLQPSRPPESYHCACPVAFTGKD
CGTEKCFDETRYEHLEEGDRWARVHQGRVEWCQCAGGHVQCEGTRHTACLSNPCLNGGTC
HLIVATGTSVCACPPDHAGRLCNIVPTQRCFKGDGTEYRGVSSTASGLSCLAWNDLLYQE
LHDSVGAAALLLGPHAYCRSALAWPTPGHRIKVGRVGSCSESNHTSCPGWSRRRVLLTLR
EPAPAGRQNCGKRHKKRSFLRPRIIGGSSSLPGSHPWLAAIYIGNNFCAGSLVHTCWVVS
AAHCFSNSPSRESVSVVLGQHFFNRTTDVTQTFGIEKYIPYPLYSVFNPSDHDLVLIRLK
KKGDRCAVRSQFVQPVCLPEPGSAFPAGHKCQIAGWGHQDENLSGYSSSLREALVPLVAD
HKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGR
LNKPGVYTRVTNYVDWINDRIRPPKRAENRS
Download sequence
Identical sequences F6ZEJ2
9796.ENSECAP00000016522 ENSECAP00000016522 ENSECAP00000016522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]