SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016545 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016545
Domain Number 1 Region: 294-490
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.72e-48
Family Reprolysin-like 0.00028
Further Details:      
 
Domain Number 2 Region: 507-582
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 9.1e-17
Family Blood coagulation inhibitor (disintegrin) 0.00059
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016545
Domain Number - Region: 738-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0452
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016545   Gene: ENSECAG00000018514   Transcript: ENSECAT00000020173
Sequence length 828
Comment pep:known chromosome:EquCab2:18:80681827:80829663:1 gene:ENSECAG00000018514 transcript:ENSECAT00000020173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGSSSRRRSCGCSFLSIQRPRAAPRPAPARALARAPPCLLLVLVLLPPLAASSGPAL
GAAAPSAPHWNETAEKDLGVLADEENTSQENSSRHISPSGGLQKEITLPSRLVYYVNQDS
ESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLTLNNGLLSSDYVEIHYEDG
KPQFSKGGEHCYYHGSIRGVKDSRVALSTCNGLHGMFEDNAFVYMIEPLELIHDEKSTGR
PHIIQKTLAGQYSKQMKNLSLGGSEQWPLLSELRWLKRRRRRAVNPSRGVFEEMKYLELM
IVNDHKTYKKYRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDHIDITTN
PVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMA
VAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSIFEYRDFL
QRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGP
CCNSTSCLFQPRSYDCRDAVNSCDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYNGEC
KTRDNQCQYIWGTKASGSDKFCYEKLNTEGTEKGNCGKDGDRWVQCSKHDVFCGLLLCTN
LTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRK
CLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPKDEG
PKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Download sequence
Identical sequences F6Z8W7
9796.ENSECAP00000016545 ENSECAP00000016545 ENSECAP00000016545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]