SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016566 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016566
Domain Number 1 Region: 169-353
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-70
Family SPRY domain 0.00000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016566   Gene: ENSECAG00000019089   Transcript: ENSECAT00000020197
Sequence length 374
Comment pep:known chromosome:EquCab2:20:27349666:27365115:-1 gene:ENSECAG00000019089 transcript:ENSECAT00000020197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEQIHNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYR
LLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQQQPTRELLQDIGDTLSRAE
RIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSVDVT
LDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVEVGD
KAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRVGIF
LDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIICPMSGIDGFS
GHVGNHGHSMETSP
Download sequence
Identical sequences F6Z810
ENSECAP00000016566 9796.ENSECAP00000016566 ENSECAP00000016566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]