SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016575 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016575
Domain Number 1 Region: 1-274
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.12e-100
Family Calpain large subunit, catalytic domain (domain II) 0.000000242
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016575
Domain Number - Region: 279-296
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 0.0772
Family Calpain large subunit, middle domain (domain III) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016575   Gene: ENSECAG00000019098   Transcript: ENSECAT00000020206
Sequence length 296
Comment pep:known chromosome:EquCab2:15:65581904:65590645:1 gene:ENSECAG00000019098 transcript:ENSECAT00000020206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQELHSNPQFYSAKGKRLDLCQGVVGDCWFLAALQALTLHRDILSRVVPLNQSFTEKYAG
IFQFWFWHFGKWVPVVIDDRLPVNEAGQLVFVSSTYKNLFWGALLEKAYAKLSGSYEDLQ
LGQVSEALVDFTGGVTVTINLAEVPGNLWDILTQATYSRTLIGCQTHSGGANSYEVVLET
GLVGGHAYTLTGIRKVTWKHGPEYLVKLRNPWGKVEWKGDWSDSSSTWELLSPKEKILLL
RKDDGEFWMTLQDFKAHFMLLVICKLTPGLLSREVGQKWAYTMREGRWEKGTTAGG
Download sequence
Identical sequences F7BNM0
9796.ENSECAP00000016575 ENSECAP00000016575 ENSECAP00000016575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]