SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016587 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016587
Domain Number 1 Region: 408-618,706-744,800-846,879-997
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.06e-17
Family Pectate lyase-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016587   Gene: ENSECAG00000018674   Transcript: ENSECAT00000020221
Sequence length 1363
Comment pep:known chromosome:EquCab2:1:90223288:90286095:-1 gene:ENSECAG00000018674 transcript:ENSECAT00000020221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAARGWQDFCFKAMLTLSGLLLAHFPGAVSTAASECPDRDPKLQPWSPGHNQDHRVHIG
RGRTLLLTSSATVHSIHITDGGKLLVIKDHDETIVLRTRHILIDNGGELHAGSALCPFQG
NFSIVLYGRADEGLPPDPYYSLKYIGVGRGGTLELHGQKKLSWTFLNKTLHPGGMEEGGY
FFERSWGHRGVIVHVIDPKSGAVIHSDRFDTYSSKKESERLVQSLNAVPDGRILSIAVND
EGSRNLDDVARKAMTRLGSKHFLHLGFRHPWSFITVKGSPSSSVEDHIEYQGHRGSAAAR
VFKLFRSEHGEHFNVSSSSEWVQDVEWTEWFEHDKVSQTKGGEKISDLRAAHPGKICNRP
IDIQATTADGVNLTTEVVYKRGQDYRFACYDRGRPCQGYRVRFLCGKPVRPKLTVTVDTN
VNSTILNLEDDVRSWKPGDTLVVASTDYSMYQAEEFQVLPCKACAPNQVRVAGKPVYLHI
GGEVDGVDMRAEVGLLSRNIVIMGEMEDECYPYTNHICNFFNFDTFGGHIKFALGFKAAH
LEGVELKHMGQQLMGQYPIHFHLAGDVDERGGYDPPTYVRDLSIHHTFSRCVTVHGSNGL
LVKDVVGYNSLGHCFFTEDGPEERNTFDHCLGLLVKAGTLLPSDRDSKMCKTITEDSYPG
YIPKPRQDCNAVSTFWMANPNNNLINCAAAGSEETGFWFIFHHVPTGPSEGMYSPGYSEH
IPLGRFHNNRAHSNYRAGMIIDNGVKTTEASAKDKRPFLSIISARYSPHQDADPLKPREP
AIIKHFTAYKNQDHGAWLRGGDVWLDSCRFADNGIGLTLASGGTFPYDDGSKQEIKNSLF
VGESGNVGTEMMDNRIWGPGGLDHSGRTLPIGQNFPIRGIQFYDGPVNIQNCTFRKFAAL
EGRHTSALAFRLNNAWQSCPHNNVTSIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVF
HDVDGSVSEYPGSYLTKDDNWLVRHPDCIDVPDWRGAICSGRYAQMYIQAYKTSNLRMKI
IKNDFPSHPLYLEGALTRSTHYQQYQPVVTLQKGYTIHWDQTAPAELTIWLINFNKGDWI
RVGLCYPRGTTFSILSDVHNRLLKQTTKTGTFSRTLQMDKVEQSHPGKSYYYWDEDSGLL
FLKLKAQNEREKFAFCSVKGCERIKIKAAIPKNAGISDCTATAYPRFAERAVVDVPMPKK
LFGAQLKTKDHFLEVKMESSEQPFFHLLSNFAYIEVDGKRYPSTEDGIQVVVIDGSQGRV
VSHASFRNAILQGIPWQVFNYVAAIPDNSIVLMASKGRYISRGPWTRVLEKLGADEGLRL
REKMAFIGFKGSFRPTWVTLDTEDHKAKIFQVVPIPVVRKKKL
Download sequence
Identical sequences F7BND2
ENSECAP00000016587 ENSECAP00000016587 9796.ENSECAP00000016587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]