SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016643 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016643
Domain Number 1 Region: 3-149
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000912
Family Integrin A (or I) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016643   Gene: ENSECAG00000018884   Transcript: ENSECAT00000020284
Sequence length 518
Comment pep:known chromosome:EquCab2:1:126803505:126832817:1 gene:ENSECAG00000018884 transcript:ENSECAT00000020284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVVVMDVSLSMTRPVSLEGSEEYQRKHLAAHGLTMLFEHMATNYKLEFTALVVFSSLW
ELMVPFTRDYNTLQEALSNMDDYDKTCLESALVGVCNIVQQEWGGAIPCQVVLVTDGCLG
IGRGSLRHSLATHSQRSENNRFPLPFPFPSKLYIMCMANLEELQSTDSLDCLERLIDLNN
GEGQIFTIDGPLCLKNVQSMFGKLIDLAYTPFHAVLKCGHLTADVQVFPRPEPFVVDEEI
DPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSAN
QIAGKIPNFCVLLHGSLKVEGMVAIVQLGPEWHGMLYSQADSKKKSNLMMSLFEPGPEPL
PWLGKMAQLGPISDAKENPYGEDDNKSPFPLQPKNKRSYAQNVTVWIKPSGLQTDVQKIL
RNARKLPEKTQTFYKELNRLRKAALAFGFLDLLKGVADMLERECTLLPDTAHPDAAFQLT
HAAQQLKLASTGTSEYAGYDHNITPLQTDFSGSSTERM
Download sequence
Identical sequences F7B0T3
ENSECAP00000016643 XP_001497853.1.31192 XP_005603044.1.31192 XP_008506600.1.77740 XP_008506602.1.77740 XP_008506603.1.77740 XP_008506604.1.77740 XP_014589378.1.31192 9796.ENSECAP00000016643 ENSECAP00000016643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]