SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016651 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016651
Domain Number 1 Region: 611-912
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-73
Family Protein kinases, catalytic subunit 0.0000013
Further Details:      
 
Domain Number 2 Region: 33-192
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.02e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016651   Gene: ENSECAG00000018474   Transcript: ENSECAT00000020293
Sequence length 920
Comment pep:known chromosome:EquCab2:20:29867977:29878949:1 gene:ENSECAG00000018474 transcript:ENSECAT00000020293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRGLSFPLLLLLLLLLVATGDADMKGHFDPAKCRYALGMQDRTIPDGDISASSSWSDS
TAARHSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSP
SYRLRYSRDGHRWMDWRDRWGQEVILGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSV
CLRVELYGCLWKDGLLSYTAPVGQTMYLSEAVHLNDSTYDGHTTHTIGGLQYGGLGQLAD
GVVGLDDFRKSQELRVWPGYDYVGWSNHSFPSGYVEMEFEFDRLRAFQAMQVHCNNMHTL
GARLPGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARTVSVPLGGRVGRFLQCRFLFA
GPWLLFSEISFISDVVNDSSLALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEG
SPTAILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILIN
NRPGPREPPPYQEPRPRGNPPHSAPSVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPA
WAKPTNTQACSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPP
GVAGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVESPQDLVSLDFPLNVRKGHPLLVA
VKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFL
SAHQLEDKAAEGSPGDGEADQGSTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCL
VGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTL
WEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPLGLYELMLRCWSREPE
QRPPFSQLYQFLAEDALNTV
Download sequence
Identical sequences F7B0E0
ENSECAP00000016651 XP_014590126.1.31192 ENSECAP00000016651 9796.ENSECAP00000016651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]