SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016702 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016702
Domain Number 1 Region: 17-53
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000122
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 58-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 98-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016702   Gene: ENSECAG00000019236   Transcript: ENSECAT00000020348
Sequence length 333
Comment pep:known chromosome:EquCab2:12:2562777:2747106:1 gene:ENSECAG00000019236 transcript:ENSECAT00000020348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAEGQLLPGNNFTNECNIPGNFMCGNGRCVPGAWQCDGLPDCFDGSDEKECPKAKSKCG
PTFFPCASGVHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFIC
DGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLAL
VLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCSVTYNVNNGIQYVASQAEQNASD
VGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSANSASSQAASSLL
STEEAGHSPGQPGPREGAAEPRDSVPSQGPEEV
Download sequence
Identical sequences F7AD24
ENSECAP00000016702 ENSECAP00000016702 9796.ENSECAP00000016702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]