SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016707 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016707
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily E set domains 2.55e-80
Family Arrestin/Vps26-like 0.000000128
Further Details:      
 
Domain Number 2 Region: 171-386
Classification Level Classification E-value
Superfamily E set domains 3.55e-68
Family Arrestin/Vps26-like 0.0000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016707   Gene: ENSECAG00000018471   Transcript: ENSECAT00000020354
Sequence length 402
Comment pep:known chromosome:EquCab2:11:49759914:49765212:-1 gene:ENSECAG00000018471 transcript:ENSECAT00000020354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGRE
DLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCS
VTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAET
TRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFST
AQYKCPVAQIEQDDQVSPSSTFCKVYTITPLLSNNREKRGLALDGKLKHEDTNLASSTIV
KEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHITLPRPQSAAPETDA
PVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDEDYDDQFC
Download sequence
Identical sequences F7ACY5
ENSECAP00000016707 ENSECAP00000016707 9796.ENSECAP00000016707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]