SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016747 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016747
Domain Number 1 Region: 209-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000172
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 2 Region: 272-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 155-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016747   Gene: ENSECAG00000019279   Transcript: ENSECAT00000020405
Sequence length 365
Comment pep:known chromosome:EquCab2:10:18690795:18695614:-1 gene:ENSECAG00000019279 transcript:ENSECAT00000020405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTFALLLFLSQATADPCYHPGGQPRFCLPPVTQLAGMAASCPQACALSPGADPGPRAT
CNGSLTLALGGPFLLTSISLRFCTPGPPALVLSASWATGGPWRSLWRRPAWPGALGGPEK
VTFRAPPPKSSVVSSHLRMEFGVRAGLAAGVRGRCQCHGHAARCAARARPPPRCRHHTTG
PGCESCRPSHRDWPWRPATPWHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCR
HHTAGRHCHYCQPGFWRDPSQPITSRKACRACQCHPIGATGGTCNQTSGQCSCKLGVTGL
TCNRCGPGYQQSRSPRMPCQRIPEATTTLSTTPGAYSSDPQCQNYCNISDTRVHMNLRRY
CQQDY
Download sequence
Identical sequences F7A896
9796.ENSECAP00000016747 ENSECAP00000016747 ENSECAP00000016747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]