SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016808 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016808
Domain Number 1 Region: 113-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000117
Family Cripto EGF-like domain-like 0.00041
Further Details:      
 
Domain Number 2 Region: 78-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000298
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016808   Gene: ENSECAG00000019331   Transcript: ENSECAT00000020478
Sequence length 188
Comment pep:known chromosome:EquCab2:16:40193716:40197288:-1 gene:ENSECAG00000019331 transcript:ENSECAT00000020478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDRRKMERFSCSVIMVMAISTAFELGLVAGLGHHELARPSQGDLAFRADTVRSQEEPAVR
RRQPFQFVPSTGIQDSKELNKTCCLNGGTCMLGSFCACPPSFYGRNCEHDLRKENCGSVP
HGTWLPRRCSMCKCWHGQLRCFPQAFLPGCDGHVMDEHLAASRTPELILSACTTLTLAGI
CLAIQSYC
Download sequence
Identical sequences F6ZDD1
ENSECAP00000016808 9796.ENSECAP00000016808 ENSECAP00000016808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]