SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016809 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016809
Domain Number 1 Region: 666-734
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.03e-20
Family TB module/8-cys domain 0.00054
Further Details:      
 
Domain Number 2 Region: 1578-1637
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1412-1468,1496-1504
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.28e-16
Family TB module/8-cys domain 0.00027
Further Details:      
 
Domain Number 4 Region: 938-1054
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000973
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 852-970
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000149
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 6 Region: 1016-1134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 1119-1219
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 550-614
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000327
Family TB module/8-cys domain 0.0028
Further Details:      
 
Domain Number 9 Region: 1184-1306
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000761
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 615-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000622
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 11 Region: 1732-1817
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 12 Region: 1300-1355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000524
Family EGF-type module 0.007
Further Details:      
 
Domain Number 13 Region: 1476-1527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000218
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 14 Region: 1521-1566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000714
Family EGF-type module 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016809
Domain Number - Region: 190-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000279
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 399-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000685
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1343-1384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0435
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016809   Gene: ENSECAG00000018631   Transcript: ENSECAT00000020479
Sequence length 1820
Comment pep:known chromosome:EquCab2:24:20049629:20147463:-1 gene:ENSECAG00000018631 transcript:ENSECAT00000020479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPTTVRCPGRARRNPWRSFLPLTLALFVGLGHAQREPVGRQEPAGRDANRLRRPGGSH
PAAAAAKVYSLFREQDAPLPGLPPTERAQLGWGSPRRPTEAEARRPPRAQQPRRVQPPAQ
TRRSSPSGQQQPTPRARAAPVLPRLGTLQRPRAAPPTPRGRLTGRNVCGGQCCPGWTTAN
STNFCIKPVCQPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPEEEFDPQNARPAPRRAAE
ASPSLRRSSTTREGTVARTRPPAPQLPLASQSPDPATLSGLSQTQPSQQHVGLSRTVRLY
PAPAASGQLTSNALPAGPGLERRDGAQQAAYLDPLSSPWGLNLTEKIKKIKIVFTPTICK
QTCARGHCANSCERGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPTN
STGKFCHLPAPKLDREPSERGSRHRAPLGGPLRQSTFTLPLSNQLASVNPSLVKVHIRHP
PEASVQVHQVARVRGEAEEAQEENSVESRPAPRLPASPSHSHWDSNSIPARSGEAPRPLP
PAAPRPRGLLGRCYLSAVNGQCANPLLELTAQEDCCGSVGAFWGVTSCAPCPRRPASPVI
ENGQLECPKGYKRLNLTHCQDINECLTLGLCKDSECVNTRGSYLCTCRPGLMLDPSRSRC
VSDKAVSMQQGLCYRSVGPGTCALPLAQRITKQICCCSRVGKAWGSKCEKCPLLGTEAFK
EICPAGHGYTYSSSDIRLSMRKAEEEELARPSREQEQKSNRTLPGPAERQPLRAATDTWL
EAETIPDKGDSQTGQVTTSVTQVPAWVPGEPTPSLPGQGTPETWQEEQVTTPTDVLVTLA
PSGIDRCAAGGTNICGPGTCVNLPDGYRCICNPGYRLHPSQAYCTDDNECLRDPCAGKGR
CVNRVGSYSCFCYPGYTLVSSGSTQECQDIDECEQPEVCTGGRCTNTEGSYHCKCDEGYI
MVRKGHCQDIDECRHPGTCPDGRCVNSPGSYTCLACEEGYRGQSGSCIDVNECLTPGVCT
HGKCINLEGSFRCSCEQGYEVTSDEKGCQDVDECASRASCPAGLCLNTEGSFSCSACESG
YWVNEDGTACEDLDECAFPGVCPSGICTNTAGSFSCKDCEEGYQPSPLGHTCEDVDECED
LQSSCLGGECKNTAGSYQCLCPQGFQLANGTVCEDVDECMREEYCAPRGECLNSHGSFFC
LCAPGFASADGGTSCQDVDECAVTDRCLGGHCVNTEGSFNCLCDTGFQTSPESGECVDID
ECEDSGDSVCGAWRCENSPGSYRCVLGCQPGFHVAPNGDCIDIDECANDTVCGSHGFCDN
TDGSFRCLCDQGFETSSSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDA
QEGHCRPRVAGGQSIPEAPPGDHLPGPTRMECYSGQNSQPHCSSLLGRNTTQAECCCTQG
ASWGDACDPCPAEDSVEFSEICPSGKGYIPVEGAWLFGQTTYTDADECAMFGPGLCQNGR
CLNTVPGYICLCSPGYHYNAAHRKCEDHDECQDMACENGECVNTEGSFHCFCSPPLTLDL
SQQRCVNSTSAIEDLPDHDIHMDICWKKVTNYVCSQPLHGRRTTYTECCCQDGEAWSQQC
ALCPPRSSEVYAQLCNVARIEAEREAGVHFRPGYEYGPGPEDLHYSLYSPDGAPFYNYLG
PEDTIPEPPFPNTASRPGDHTLVLESPLQPSELQPHYVASHPEHQAGFEGLQAEECGILN
GCENGRCVRVREGYTCDCFEGFQLDTAHMACVDVNECDDLNGPAALCVHGHCENTEGSYR
CHCSPGYVAEAGPPHCIAKE
Download sequence
Identical sequences F6ZDB7
9796.ENSECAP00000016809 ENSECAP00000016809 ENSECAP00000016809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]