SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016818 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016818
Domain Number 1 Region: 1258-1309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 2 Region: 438-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 393-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 199-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 5 Region: 256-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 6 Region: 533-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 7 Region: 1307-1355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 8 Region: 481-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 9 Region: 326-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016818
Domain Number - Region: 586-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000279
Family Laminin-type module 0.025
Further Details:      
 
Domain Number - Region: 16-125
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00149
Family APC10-like 0.061
Further Details:      
 
Domain Number - Region: 1214-1255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0628
Family Laminin-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016818   Gene: ENSECAG00000019238   Transcript: ENSECAT00000020488
Sequence length 1376
Comment pep:known chromosome:EquCab2:8:45406455:45543511:1 gene:ENSECAG00000019238 transcript:ENSECAT00000020488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGQFCDYCNSEDPRRAHPITNAIDGSERWWQSPPLSSGTRYNKVNVTLDLGQLFHVAYVL
IKFANSPRPDLWVLERSVDFGSTYSPWQYFAHSKVDCLEQFGREANMAVTRDDDVLCTTE
YSRIVPLENGEVVVSLINGRPGKNFTFSHTLRVHQGNKLPFFLRTNTLLGHLISKAQRDP
TVTRRYYYSIKDISIGGRCVCNGHADVCNANNPEKLFRCECRHHTCGETCDRCCAGYNQR
RWRPGTWGQSNECEACNCHGHAIDCYYDPDVERQQASLNIQGIYAGGGVCINCQHNTAGV
NCEKCAKGYFRPYGIPLDAPDGCIPCSCNPEHAEDCEQGSGRCTCKPNFQGDHCEKCAAG
YHNFPFCLRIPIFPISTPSPEDPVAGEIKGKWCDCNLEGVLPEICDAQGRCLCRPGVEGP
RCDACRSGFYSFPICQACQCSALGSYQTPCNPETGQCECRPGITGQRCDRCLSGAYDFPH
CQGSSSACDPAGTLDSSRGYCQCKPHVEGPTCSICKPLYWNLATENPNGCSECQCHAGGT
VSGIGECGQRDGDCHCKSHVSGDSCDTCEDGYFALEKSSYFGCQGCQCDIGGAISPICSG
PGGVCQCRAHIVGKACQRPGDNYYFPDLHHMKYEIEDGTTPNGRELRFGFDPLEFPGFSW
RGYAQMSPVQNEVKIMLNVGTSSLTLFRVILRYINPGTEAVSGRVTIYPSWAKAGGKEII
FLPSKEPAFVTVPGNGFADPFSIGPGKWIACIKAEGVLLDYLVLLPRDYYEASSLQLPVT
EPCADAGPPQENCLLYQHLPVTRFPCALACEARHFLLDGEPRPLAMSQPTPAHPVMADLS
GREVELRLRLRVPQVGRYVLLVEYATEVDQLSVVDVHMESSGSVLAGQVDIYSCKYSVLC
RSAVTDGRSRIPVYELLADADIRLKAHMARFLLHQICIIPVEEFSTEYLRPQVRCIASYG
RFINQSATCVSLAPETPPTALILDVPSGESYPLLPQDPSPSASVVTGVTLKAPQNQMTLR
GLVPHGGRYVFVIHFYQPAHPTFPAQVSVDRGQPRAGVFRASFCPHVLGCWDQVIAEDQV
EFDISEPEVAVTVKVPEGRSLVLVRVLVVPAENYDYQILHKKSVNKSFEFIANCGGNSFY
TDPQTASVFCKNSTRSLVALYHNGALPCECHPTGSIGHHCSPEGGARAGPTSLGGSVPAV
ERVYGFPHCKRKACSCGQHLCEEMTGKCLCPPRTVRPQCEVCETHSFSFHPLAGCKGCNC
SRRGTLEAATPECDRDHGQCRCKPRITGRQCDRCASGFYHFPECIPCHCNRDGTEPAVCD
PGTGACLCKENVEGTECNVCREGSFYLDPANPKGCTSCFCFGVNNHCHSTHKRRAK
Download sequence
Identical sequences F6ZCR0
9796.ENSECAP00000016818 ENSECAP00000016818 ENSECAP00000016818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]