SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016845 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016845
Domain Number 1 Region: 307-471
Classification Level Classification E-value
Superfamily vWA-like 3.42e-25
Family Integrin A (or I) domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016845
Domain Number - Region: 751-793
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00486
Family Fibronectin type III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016845   Gene: ENSECAG00000018975   Transcript: ENSECAT00000020519
Sequence length 913
Comment pep:known chromosome:EquCab2:5:77472150:77500196:-1 gene:ENSECAG00000018975 transcript:ENSECAT00000020519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFKSSVFILVLHLLEGALSNSLIHLNNNGYEGIVIAIDPNVPEDETLIQQIKDMVTQA
SPYLFEATEKRFYFKNVAILVPENWKTKPEYERPKLETYKNADVLVAEPNPPGNDQPYTE
QMGKCGEKGERIYFTPDFLAGKRLDEYGPQGRVFVHEWAHLRWGLFNEYNDDQKFYLSNK
EIKPVKCSADIAGKNVVNHCQGGSCATKPCRRDRVTGLYAQECEFIPDEQQTEKASIMFS
QSIDSVVEFCTEENHNREAPNMQNQRCNLRSTWEVIRDSEDFKKTTPMTAQPPQPTFSLL
QIGQRIVCLVLDKSGSMAIGDRLKRLTQAGKLFLLQTVEQGSWVGMVTFDSAAYVQSALR
QIKGGTDRDALTKSLPTVASGGTSICSGLRSAFTVIRKKYKTDGSEIVLLTDGEDNTISS
CFNEVKQSGAIIHTVALGPSAAAELEELSKMTGGLQTYASDQAQNNGLIDAFGALSSGNG
AVSQHSIQLVSRGSTLQNSQWMNGTVIVDSTVGNDTLFLITWTSQPPQILLWDPSGKKQD
GFVVDTNTKMAYLQVPGTAKVGTWTYSLQASSQTLTLTVTSRASSATLPPVTVTSKVNKD
TGKFPSPVVVYAKIHQGGLPILRATVTALIESVDGKTVTLELLDNGAGADATKDDGIYSR
YFTAYNTNGRYSIKVWALGGVNAARQMGISQQNGAMYRAGRMKNGEIIWNPPRPKINIDD
LLSKQVPFSRTSSGGSFVASNVPNAPIPDLFPPCQITDLKAKIQGDSLINLTWTAPGDDY
DHGRADRYIIRISTNILDLRDKFNDSLQVNTTDLIPKEATSEEVFVFKPENIAFENGTDL
FIAIQAVDEVDLESEISNIAQVSLFLPPQTPPETPSPSLPCPDSNITSAIPGIHILKVMW
KWLGELQLSVALG
Download sequence
Identical sequences Q2TU62
9796.ENSECAP00000016845 NP_001075268.1.31192 ENSECAP00000016845 ENSECAP00000016845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]