SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016855 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016855
Domain Number 1 Region: 142-385
Classification Level Classification E-value
Superfamily vWA-like 1.09e-76
Family Integrin A (or I) domain 0.000000571
Further Details:      
 
Domain Number 2 Region: 386-472
Classification Level Classification E-value
Superfamily Integrin domains 3.14e-21
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 3 Region: 44-102
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000309
Family Plexin repeat 0.00073
Further Details:      
 
Domain Number 4 Region: 590-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family Integrin beta EGF-like domains 0.0066
Further Details:      
 
Domain Number 5 Region: 546-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000016855
Domain Number - Region: 510-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000809
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016855   Gene: ENSECAG00000019215   Transcript: ENSECAT00000020530
Sequence length 767
Comment pep:known chromosome:EquCab2:4:52216357:52290263:1 gene:ENSECAG00000019215 transcript:ENSECAT00000020530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRSTLAFFTAAFVCLQNCRPGPAPFLRAAWVFSVVLGLGQSEDNRCASSNAASCTKCLA
LGPECGWCAQEDFISGGSRSVRCDIVSNLISKGCLIDSIEYPSVHVMPSENEINTQVTPG
EVSIQLRPGAKANFMLKIHPLKQYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFS
RDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNVYVRSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYQKLISEVKVQVENQAKGIYFNITAICPDGTRKPGTDGCGN
VTSNDEVLFNVTVTMKKCDVTEGKSYAIIKPIGFNETTKIHIHRNCSCQCDDSRGSKRKC
VDETFLDAKCFQCDENKCHFDEDQFPSESCKSHKDQPVCSGRGVCICGKCLCHKIKLGKV
YGKYCEKDDFSCPYHQGNLCAGHGECEAGRCQCFSGWEGDRCQCPSASAQHCVNPKGQVC
SGRGTCVCGKCECTDPKSIGRFCEHCPTCHTACNENWNCVQCLHPHNLSQAILDRCKTSC
ALMEQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSADY
RVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Download sequence
Identical sequences F7BLS7
ENSECAP00000016855 XP_001497271.1.31192 XP_008531716.1.77740 ENSECAP00000016855 9796.ENSECAP00000016855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]