SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017006 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017006
Domain Number 1 Region: 7-296
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 6.02e-60
Family SGL-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017006   Gene: ENSECAG00000019562   Transcript: ENSECAT00000020706
Sequence length 299
Comment pep:known chromosome:EquCab2:X:38222446:38234198:1 gene:ENSECAG00000019562 transcript:ENSECAT00000020706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIKIECVLPENCQCGESPVWEEASSSLLFVDIPAKKVCRWDALSKQVQRMTVDAPVGS
VALRQSGGYVATIGTKFCALNWEDQSVVVLAAVEKDKKNNRFNDGKVDPAGRYFAGTMAE
ETAPAVTERHQGSLYALFPDHHVEKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDY
DLLTGRISNRRSVYKLEKEEHIPDGMCIDTEGKLWVACYNGGRVIRLDPETGKRLQTVKL
PVDKTTSCCFGGKDYSEMYVTCARAGLDPEALSRQPEAGGIFKITGLGVKGIPPYAYAG
Download sequence
Identical sequences A0A0B4J1C3
ENSECAP00000017006 ENSECAP00000017006 NP_001229377.1.31192 XP_008506285.1.77740 XP_008506286.1.77740 XP_014584224.1.31192 XP_014584225.1.31192 XP_014584226.1.31192 XP_014584227.1.31192 9796.ENSECAP00000017006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]