SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017015 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017015
Domain Number 1 Region: 162-319
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 2.22e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 16-164
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 320-432
Classification Level Classification E-value
Superfamily E set domains 1.12e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017015   Gene: ENSECAG00000019257   Transcript: ENSECAT00000020717
Sequence length 486
Comment pep:known chromosome:EquCab2:3:98665486:98730624:-1 gene:ENSECAG00000019257 transcript:ENSECAT00000020717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVY
LMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSD
KRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLR
SQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSV
TGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCP
KEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELT
GQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGI
IYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNVSTNSTSVTSS
TATVVS
Download sequence
Identical sequences F7E3E6 I3LDF9
ENSSSCP00000022090 ENSECAP00000017015 ENSECAP00000017015 ENSSSCP00000022090 NP_001288148.1.31192 XP_003128938.2.46622 XP_004419017.1.5094 XP_005207868.1.76553 XP_005666625.1.46622 XP_005666626.1.46622 XP_005897155.1.15283 XP_008512011.1.77740 XP_010838232.1.44457 XP_010838233.1.44457 XP_014711388.1.49734 XP_019818111.1.53367 9796.ENSECAP00000017015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]