SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017016 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017016
Domain Number 1 Region: 1037-1301
Classification Level Classification E-value
Superfamily Kelch motif 8.63e-40
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 744-792
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 3 Region: 607-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000177
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 696-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 5 Region: 1730-1780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017016
Domain Number - Region: 1658-1693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000217
Family EGF-type module 0.071
Further Details:      
 
Domain Number - Region: 14-82
Classification Level Classification E-value
Superfamily Kelch motif 0.000288
Family Kelch motif 0.046
Further Details:      
 
Domain Number - Region: 947-1015
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00345
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 1824-1859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Laminin-type module 0.025
Further Details:      
 
Domain Number - Region: 2002-2011
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0131
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017016   Gene: ENSECAG00000019381   Transcript: ENSECAT00000020718
Sequence length 2318
Comment pep:known chromosome:EquCab2:10:13430426:13459915:-1 gene:ENSECAG00000019381 transcript:ENSECAT00000020718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVYGGNVHTHYQEEKCYEDGIFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAA
VLGGSVLLVAGGYSGRPRGDLMAYKVPPFVFQAPAPDVSTGVTGERVAGLGFTRDKGKSW
GGGARTFPPPSWALTACPAASCLGLGRLLGDCQACLAFSSPAAPPRGPGALGWCVHNESC
LPRPEQARCRGEQISGTVGWWGPAPVFVTSLEACITQSFLPGLHLLTFQQPPNASQPDKV
LIVRSTTITLTPSPETDVSLVYRGFIHPLLPGGPGGPGAEDVAVWARAQRLHVLARMARG
PDTENMVRGRTEEELEVLGMWRGGPAVFSCEENGGEILKVGELQTPTPIPNLDFWLLTRA
WTPDPHEISFFFLEPYRSSACASYSSCFGCLADQGCGWCLTSATCHLRQSGAHCGADGAG
GSLLVLVPALCPLCEEHRDCHACTQDPFCEWHQSTSRKGDAACSRRGRGLGALKSPEECP
PLCSQRLTCDDCLANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCD
RFLTCHECLQSHECGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLSVALPARW
AYARCPDVDECRLGLARCHLQATCLNTPLSYECHCQRGYQGDGVTHCSRTCLEDCGHGVC
SGPPDFTCVCDLGWTSDLPPPTPAPGPPAPRCSRDCGCNFHSHCRKLGPGFCDECQDWTW
GEHCERCRPGSFGNATGSGGCRSCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSP
GYYGDPRAGGSCFRECGGRALLTNVSSVALGSRRVGGLLPPGGGAARTGTGLSYCVWVVS
ATEVLQPCAPGTLCPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFC
GQRRDRPLTVQALSGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDEA
AGAGLCRCPQGWAGPHCRMALCPENCNAHSGAGTCNQSLGVCICAEGFGGPDCATKLDGG
QLVWETLMDSRLSADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSER
RWTQMLAGAEDGGPGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWR
QEKVPQTVELPAVAGHTLTARRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGT
PPTGLYGHSAVYHEATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKPR
PRLFHASALLGDTMVVLGGRSDPDEFSSDVLLYQVNCNAWLLPDLTRPASVGPPMEESVA
HAVAAVGGRLYISGGFGGVALGRLLALTLPPDPCRLLPSPEACNQSGACTWCHRACLSGD
QAHRLGCGDPPCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASAPRCKWCTNCPEG
ACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETR
RILSVQPTYDWTCFSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHC
VWSSSLQQCLSPSYLPLRCMAGGCGRLLRGPESCSLGCAQASQCALCLRRPHCGWCAWGG
QDGGGSCLEGGLSGPREGLTCGRPGTSWAFLSCPPEDECANGHHDCNETQNCHDRPHGYE
CSCKTGYTMDNVTGLCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAG
VGARDHCLLCRNHTKGSHCEQCLPLFVGSAVGGGTCRPCHAFCRGNSHVCVSRKELEMAR
REPEKYSLDPEEIENWVTEGPSEDEAVCVSCQNNSYGDKCESCLHGYFLLDGKCTKCQCN
GHADTCNEQDGTGCPCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYR
LISVEQECCLDPTSQTNCFHEPKRRTLGPGRTVLFVQPKFTNDIRLTDVTFGAVDLYVST
SYDTFVVRVAPDTSVHTVHIQPPPPPPPPPPADSEPRETGDPGGPGPGTVPGTTAEPRVR
EVWPRGLITYVTVTEPSAVLVVRSVRDRLVITYPHEHHALKSSRFYLLLLGVGDPNGPGA
NGSADSQGLLFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQ
EMTKMASRPFAKVTVCFPPDPAAPAPTWKPAGLPPPTFRRSEPFLAPLLLTGAGGPWGPV
GGGCCPPAIPTTTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLR
HRLHEYCGGGGGAGGSGHGAGAGRKGLLSQDNLTSMSL
Download sequence
Identical sequences F7E3D8
ENSECAP00000017016 9796.ENSECAP00000017016 ENSECAP00000017016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]