SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017076 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017076
Domain Number 1 Region: 53-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-22
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 2 Region: 236-338
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.68e-20
Family Platelet-derived growth factor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017076   Gene: ENSECAG00000019512   Transcript: ENSECAT00000020781
Sequence length 345
Comment pep:known chromosome:EquCab2:2:77226011:77432480:1 gene:ENSECAG00000019512 transcript:ENSECAT00000020781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFGLLLLTSALAGQRHGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNMDLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSALPPSA
LPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKNGVRGLHKSLTDVALEHHEECDCVCRGNSGG
Download sequence
Identical sequences F7DYB8
9796.ENSECAP00000017076 XP_001500695.1.31192 XP_008512664.1.77740 XP_014699555.1.49734 ENSECAP00000017076 ENSECAP00000017076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]